KEGG   Sus scrofa (pig): 100736957Help
Entry
100736957         CDS       T01009                                 

Gene name
POLD4
Definition
polymerase (DNA-directed), delta 4, accessory subunit
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ssc  Sus scrofa (pig)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ssc00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssc00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ssc03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ssc03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ssc03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ssc03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssc03440]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ssc05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 179 aa AA seqDB search
MLVGVGERRHSWNPRTSFLPVWVICLPTRRWPQARSLAPALSPSLSSCLFRARWPVSSSP
QSPPSPPAWVAAMGRKRLITDSYPVVKRREGPAGHSKGELALKLEPEPPPPSVDEAELEL
LRQFDLAWQYGPCTGITRLQRWHRAEQMGLAPPPEVRQVLQTHPGDPRFQCSLWHFYPL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgggggtgggggagaggcgtcattcctggaaccctcggacttcctttctgccg
gtctgggtcatctgtctgcccacccgtcgctggccccaggctcgctctctggccccagcc
ctctctccctctctcagcagctgtctctttcgtgcccgctggcctgtctcttcttccccg
cagtcgcctccttctccgcctgcctgggtggccgccatgggccggaagcggctcatcact
gactcctacccagtagtgaagaggagggagggccccgctgggcacagcaagggggagctg
gcactgaagctagagcccgagcccccgcccccgagcgtggatgaagcggagctggagctg
ctgaggcagtttgacctggcctggcagtatgggccctgcacagggatcacacggctgcag
cgctggcatcgggcagagcagatgggcctggcgccaccgccagaagtgcgccaggtgctg
cagactcaccccggggatccccgcttccagtgcagcctctggcacttctaccccctttga

DBGET integrated database retrieval system