KEGG   Sus scrofa (pig): 100736957Help
Entry
100736957         CDS       T01009                                 

Gene name
POLD4
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00230  Purine metabolism
ssc00240  Pyrimidine metabolism
ssc01100  Metabolic pathways
ssc03030  DNA replication
ssc03410  Base excision repair
ssc03420  Nucleotide excision repair
ssc03430  Mismatch repair
ssc03440  Homologous recombination
ssc05166  HTLV-I infection
Module
ssc_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100736957 (POLD4)
   00240 Pyrimidine metabolism
    100736957 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100736957 (POLD4)
   03410 Base excision repair
    100736957 (POLD4)
   03420 Nucleotide excision repair
    100736957 (POLD4)
   03430 Mismatch repair
    100736957 (POLD4)
   03440 Homologous recombination
    100736957 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100736957 (POLD4)
DNA replication proteins [BR:ssc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100736957 (POLD4)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100736957 (POLD4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     100736957 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 100736957
NCBI-ProteinID: XP_005660694
Ensembl: ENSSSCG00000012916
UniProt: F1RUX5
Position
2
AA seq 181 aa AA seqDB search
MLVGVGERRHSWNPRTSFLPVWVICLPTRRWPQARSLAPALSPSLSSCLFRARWPVSSSP
QSPPSPPAWVAAMGRKRLITDSYPVVKRREGPAGHSKGELALKLEEEPEPPPPSVDEAEL
ELLRQFDLAWQYGPCTGITRLQRWHRAEQMGLAPPPEVRQVLQTHPGDPRFQCSLWHFYP
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgggggtgggggagaggcgtcattcctggaaccctcggacttcctttctgccg
gtctgggtcatctgtctgcccacccgtcgctggccccaggctcgctctctggccccagcc
ctctctccctctctcagcagctgtctctttcgtgcccgctggcctgtctcttcttccccg
cagtcgcctccttctccgcctgcctgggtggccgccatgggccggaagcggctcatcact
gactcctacccagtagtgaagaggagggagggccccgctgggcacagcaagggggagctg
gcactgaagctagaggaagagcccgagcccccgcccccgagcgtggatgaagcggagctg
gagctgctgaggcagtttgacctggcctggcagtatgggccctgcacagggatcacacgg
ctgcagcgctggcatcgggcagagcagatgggcctggcgccaccgccagaagtgcgccag
gtgctgcagactcaccccggggatccccgcttccagtgcagcctctggcacttctacccc
ctttga

DBGET integrated database retrieval system