KEGG   Sus scrofa (pig): 100737416Help
Entry
100737416         CDS       T01009                                 

Gene name
USP32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 352 aa AA seqDB search
MYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFL
VPRDPALCQRKPLTPQGDDLSEPRVAAGEVKRGDAQNSAGEDDVLLSKSPSSLSANVISS
PKGSPSSSRKSGASCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDTSRE
NGAGQVCELADNLSRGHMLGGSQPELVTPQDHEVALANGFLYEHEACGNGYSNGQLENHS
EEDSTDDQREESRVKPIYNLYAISCHSGILGGGHYVTYAKNPNSKWYCYNDSSCKELHPD
EIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtactactgctccaagtgtaagacccactgcttggcaaccaagaagctagatctctgg
cggcttccccccatcctgattattcaccttaaacgatttcaatttgtaaatggtcgatgg
ataaaatcacagaaaattgttaaatttcctcgtgaaagttttgaccccagtgcttttctg
gtgccaagagacccagctctctgtcagcgtaagccactcacaccccagggggatgacctc
tctgagcccagggttgcggcaggagaggtgaagagaggggatgctcagaactcagcgggg
gaagacgacgtgcttctgagcaagagcccctcctcactcagtgcaaacgtcatcagtagc
cccaaaggttcaccttcttcatcaagaaaaagtggagccagctgtccctccagcaaaaac
agcagccctaacagcagccctcggactttagggaggagcaaagggaggctccggctaccc
cagatcggcagcaaaaataaactctcgagtagtaaggagaacttggataccagcagagag
aacggggctgggcaagtttgtgagctggctgataacttgagccgaggacatatgctggga
ggcagccaacctgagctggtcaccccgcaggaccacgaagtagctttggccaacggattc
ctttatgagcatgaggcatgtggcaatggctacagcaatggtcagcttgaaaaccacagt
gaggaagacagcactgatgaccaaagagaagagagtcgtgttaagcctatttataatctg
tatgcaatttcgtgccattcaggaattctgggcgggggccattacgtcacttatgccaaa
aacccaaacagcaagtggtactgttacaatgacagcagctgtaaggaacttcaccctgat
gaaatcgacaccgactctgcctacattcttttctacgagcagcaggggatagactatgca
caatttctgccaaagatcgacggcaaaaagatggcagacacaagcagcatggacgaagac
ttcgaatctgattacaagaagtactgtgtgttacagtga

DBGET integrated database retrieval system