KEGG   Sus scrofa (pig): 100737630Help
Entry
100737630         CDS       T01009                                 

Definition
glutaminase liver isoform, mitochondrial-like
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100737630
   00330 Arginine and proline metabolism
    100737630
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100737630
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100737630
  Nervous system
   04724 Glutamatergic synapse
    100737630
   04727 GABAergic synapse
    100737630
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100737630
   05206 MicroRNAs in cancer
    100737630
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100737630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 602 aa AA seqDB search
MRSMKALQNALSRAGSHCRQRGWGHLSRSPLLGGGVRHHLSEAAAQGRETPHSHQPLHQD
HDPSESGMLSRLGDLLFYTVAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMRRRVR
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTSHVDRIFEDAKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGNTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSYRGVSFCQKLVSLFNFHNYDNLRHCTRKLDPRREGG
EIRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHTDVVKFLIE
ACKVNPFVKDRWGNIPMDDAVQFNHLEVVKLLQDYQDSYTPSETQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctatgaaagctctgcagaatgcactgagccgggccggcagtcactgccggcag
agaggctggggtcacctgagccggagccctctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgcagggcagggagactccgcacagccaccagccgctgcaccaggat
catgatccgtcagaaagtggcatgctgtcccgcctgggtgatcttctcttctacacagtt
gctgagggacaggaacgaatccctatccacaagttcactactgcactgaaggctaccgga
ctgcagacgtcagatcccaggctccgggactgcatgagccagatgcgccgcagggttcga
gagtccagcagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgagccacgtggaccgcatttttgaggatgccaaagagctcacaggaggcaaagtggcg
gcctacatccctcagctggccaagtcaaatccagacctgtggggtgtctccctgtgcact
gtggatggtcagcggcactcggtgggcaacacaaagatccccttctgcctgcagtcctgt
gtgaagcccctcacctatgccatttccataagcaccctaggcactgactacgtgcacaag
ttcgtgggcaaggagcccagcggcctgcgctacaacaaactctccctcaatgaggaagga
atcccccacaaccccatggtcaacgctggtgccattgttgtgagctccctgatcaagatg
gactgtaataaagcagagaagtttgattttgtcttgcaatatctgaacaaaatggctggg
aatgaatacatgggtttcagcaatgccacattccagtcagagaaggaaacaggggatcgg
aattatgccatcggctattatctgaaggaaaagaagtgctttcccaaaggggtggacatg
atggctgccctcgatctctacttccagctgtgctccgtggaggtgacctgcgaatcaggc
agtgtcatggcagccactctggccaacggcgggatctgccccatcacgggtgagagcgtg
ctgagcgctgaagcagtgcgcaacaccctcagcctcatgcactcctgcggcatgtacgac
ttctcggggcagtttgcctttcacgtgggcctgccagccaagtcggccgtgtcaggagcc
atcctcctggtggtgcccaatgtcatgggaatgatgtgtctgtcgcctcccctggacaag
ctggggaacagttacaggggtgtcagcttctgccagaagctggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgcacacggaaattagacccacggcgtgaaggggga
gaaattaggaacaagactgtggtgaacctgttatttgctgcctatagtggagatgtctca
gctcttcgaaggtttgccttgtcagccatggacatggaacagaaagactatgactcccgc
acagctctgcatgttgctgcagctgaaggacacactgatgttgttaaattcctgattgaa
gcttgcaaagtgaatccatttgtcaaggacaggtggggcaacattcccatggatgatgct
gtgcagttcaaccacctggaggtggtgaaactgctacaagattaccaggactcatacacc
ccatccgagactcaggctgaagcagcagctgaggccttgtccaaagagaacttggagagc
atggtgtga

DBGET integrated database retrieval system