KEGG   Sus scrofa (pig): 100738199Help
Entry
100738199         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase 3-like
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100738199
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100738199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 284 aa AA seqDB search
MPFIETVYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHRKRKLLENSSLNSKLLK
VNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHT
RSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYL
LDHLHLELQGGFNGISRSSILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICG
TESRKFDPFLDLSLDIPSQFRNKRSKNQENGPVCSLRGKDFLIF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgccttttatagagacagtttatcgctgtgatgattttgtggttaatgacaccaagctg
ggactggtacagaaagtcagagaacacttacagaacttggaaaactcagctttcacagct
gacaggcataggaaaagaaaacttttggaaaactcatcactaaacagcaagttattaaaa
gtaaatggaagtaccactgccatttgtgccacaggtcttcgaaatttggggaacacgtgt
ttcatgaatgccatccttcagtcactcagtaacattgagcagttttgctgttatttcaaa
gaactacccgctgtggagttaaggaatgggaagacagcagggaggcgaacgtaccacacc
aggagccagggggacaacaacgtgtctttggtagaagagtttaggaagacactctgtgct
ttatggcaagggagccagactgcatttagcccggaatccttattttatgttgtttggaag
attatgccaaattttaggggctatcagcagcaggatgcccatgaattcatgcgctacctg
ttagaccacctgcacttggaactccagggcggtttcaatgggatctcccgctcatcaatt
ctgcaagagaattccactctgtctgcaagtaacaaatgttgcataaatggagcatctaca
gttgtcacggctatattcggaggcattctccaaaatgaggttaactgcctcatatgtggg
acagaatctagaaagtttgatccattcctagacctttcattagatattccaagtcagttc
agaaataagcgctctaagaatcaagaaaatggaccagtttgttcattacgaggtaaagat
tttttaatattctag

DBGET integrated database retrieval system