KEGG   Sus scrofa (pig): 100738292Help
Entry
100738292         CDS       T01009                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ssc  Sus scrofa (pig)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100738292 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100738292 (SPHK2)
   04020 Calcium signaling pathway
    100738292 (SPHK2)
   04071 Sphingolipid signaling pathway
    100738292 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100738292 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100738292 (SPHK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100738292 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 646 aa AA seqDB search
MKTQRPDQELTWSWGHRPRSTLDRAKAMAPPPPLPLTASTPLLHGEFGSYPARGPRFALT
LTPQALHIQRLRPKPEARPRGGLVLLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGGR
RRAARTFRADEAATYEENRAEAQRWATALTCLLRGLPLPGDGDITPDLLPRPPRLLLLVN
PFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDGIVTVSGDG
LLYEVLNGLLDRPDWEEAVKTPVGILPCGSGNALAGAVNQHGGFEPALGIDLLLNCSLLL
CRGGGRPLDLLSVTLASGSRCFSFLSVAWGFISDVDIQSERFRALGSARFTLGTVLGLAT
LHTYRGRLSYLPATVEPASPTPAHGLPRAKSELTLAPAPAPPVAHSPLHRSVSDLPLPLP
LPTLTSPGSPEPLPVLSLNGGCPELAGDWGGAGDAPLSPDPLLPSPPGSPKAAQLSPITE
GAPEMPASSELLPPTPDIPVAISTGGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSH
LGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMEHGSHFSLGCPQLGYAAARAF
RLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCLGREP
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccagaggccagaccaggagctgacctggagctggggccacaggcctaggagc
accctggacagagctaaggccatggcccccccaccgccactgcccctgaccgccagcacc
ccactcctgcatggcgagtttggttcctacccagcccgaggcccacgctttgccctcact
ctcacaccacaagccctgcacatccagcggctgcgcccgaagcctgaagcccggccacgg
ggtggcctggtcctgctggccgaggtctcaggctgctgcaccctgcggagccggagcccc
tcagactcggcagcctacttctgcatctatacctacccgaggggccggcgcgggggccgg
cgcagagctgcacgtaccttccgagccgacgaggcagccacctatgaggagaaccgtgct
gaggcccagcgctgggccactgccctcacgtgtctgctccgcgggctgccgctgcctggg
gacggggacatcacccctgaccttctgcctcggccgccccgattgctcctactggtcaat
ccctttggggggcggggcctggcctggcagtggtgtaagaaccacgtgctgcccatgatc
tctgaagctgggctgtccttcaacctcatccagacagaacgacagaaccacgcccgggag
ctggtccaggggctgagcctgagcgagtgggacggcatcgtcacagtctcgggagatggg
ctgctgtacgaggtgctgaatggactcctagatcgccccgactgggaagaggctgtgaag
accccagtgggcatcctgccctgtggctctggcaacgcactggcaggagctgtgaaccag
catggggggtttgagccggccctgggcattgacctgctgctcaactgctctttgctgctc
tgccggggtggcggccgcccactggacctgctctcggtgacgctggcctccggctcccgc
tgtttctccttcctgtctgtggcatggggcttcatatcagacgtggatatccagagcgag
cgcttcagagccctgggcagtgctcgcttcacactgggcacagtgctgggactggctaca
ctgcacacctaccgcggccgcctctcctacctccctgccaccgtggaacctgcctcaccc
actcctgcccatggtctgccacgtgccaagtcagagttgaccctggccccggccccagcc
ccacccgtggcccactcacccctgcatcgctctgtgtctgacctgcccctgcccctgccc
ctgcctaccctaacctctcctggctcacctgaacccctacctgtcctgtccctcaatggt
gggtgcccagagctggctggtgactggggtggggctggggatgccccgctatccccagat
ccactgctgccctcgccccctggctcccccaaggcagctcaactttcacccatcaccgag
ggggccccagaaatgccagcatcctctgagctcctgcctcccacccctgatatcccagta
gccatctccactgggggcccacccgaccacctgctccctcctctgggcactccactaccc
ccagactgggtgacattggagggggactttgtgcttatgttggccatctcacccagtcac
ctaggggctgacctggtggcagccccccacgcacgctttgacgacggcttggtgcacctg
tgttgggtgcgcagcggcatctcgcgggcagcactgctgcgcctttttctggccatggag
cacggcagccacttcagcctgggctgtccgcagctgggctatgccgcggctcgtgccttc
cgcctcgagcctctcacgccccgcggcgtgctgacagtggacggggagcaggtggagtat
gggccattgcaggcgcagatgcatccgggccttggtacactgctcactggtcctccgggg
tgccttgggcgggagccctga

DBGET integrated database retrieval system