KEGG   Sus scrofa (pig): 100738292Help
Entry
100738292         CDS       T01009                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ssc  Sus scrofa (pig)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100738292
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100738292
   04020 Calcium signaling pathway
    100738292
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100738292
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100738292
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100738292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 646 aa AA seqDB search
MKTQRPDQELTWSWGHRPRSTLDRAKAMAPPPPLPLTASTPLLHGEFGSYPARGPRFALT
LTPQALHIQRLRPKPEARPRGGLVLLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGGR
RRAARTFRADEAATYEENRAEAQRWATALTCLLRGLPLPGDGDITPDLLPRPPRLLLLVN
PFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDGIVTVSGDG
LLYEVLNGLLDRPDWEEAVKTPVGILPCGSGNALAGAVNQHGGFEPALGIDLLLNCSLLL
CRGGGRPLDLLSVTLASGSRCFSFLSVAWGFISDVDIQSERFRALGSARFTLGTVLGLAT
LHTYRGRLSYLPATVEPASPTPAHGLPRAKSELTLAPAPAPPVAHSPLHRSVSDLPLPLP
LPTLTSPGSPEPLPVLSLNGGCPELAGDWGGAGDAPLSPDPLLPSPPGSPKAAQLSPITE
GAPEMPASSELLPPTPDIPVAISTGGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSH
LGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMEHGSHFSLGCPQLGYAAARAF
RLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCLGREP
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccagaggccagaccaggagctgacctggagctggggccacaggcctaggagc
accctggacagagctaaggccatggcccccccaccgccactgcccctgaccgccagcacc
ccactcctgcatggcgagtttggttcctacccagcccgaggcccacgctttgccctcact
ctcacaccacaagccctgcacatccagcggctgcgcccgaagcctgaagcccggccacgg
ggtggcctggtcctgctggccgaggtctcaggctgctgcaccctgcggagccggagcccc
tcagactcggcagcctacttctgcatctatacctacccgaggggccggcgcgggggccgg
cgcagagctgcacgtaccttccgagccgacgaggcagccacctatgaggagaaccgtgct
gaggcccagcgctgggccactgccctcacgtgtctgctccgcgggctgccgctgcctggg
gacggggacatcacccctgaccttctgcctcggccgccccgattgctcctactggtcaat
ccctttggggggcggggcctggcctggcagtggtgtaagaaccacgtgctgcccatgatc
tctgaagctgggctgtccttcaacctcatccagacagaacgacagaaccacgcccgggag
ctggtccaggggctgagcctgagcgagtgggacggcatcgtcacagtctcgggagatggg
ctgctgtacgaggtgctgaatggactcctagatcgccccgactgggaagaggctgtgaag
accccagtgggcatcctgccctgtggctctggcaacgcactggcaggagctgtgaaccag
catggggggtttgagccggccctgggcattgacctgctgctcaactgctctttgctgctc
tgccggggtggcggccgcccactggacctgctctcggtgacgctggcctccggctcccgc
tgtttctccttcctgtctgtggcatggggcttcatatcagacgtggatatccagagcgag
cgcttcagagccctgggcagtgctcgcttcacactgggcacagtgctgggactggctaca
ctgcacacctaccgcggccgcctctcctacctccctgccaccgtggaacctgcctcaccc
actcctgcccatggtctgccacgtgccaagtcagagttgaccctggccccggccccagcc
ccacccgtggcccactcacccctgcatcgctctgtgtctgacctgcccctgcccctgccc
ctgcctaccctaacctctcctggctcacctgaacccctacctgtcctgtccctcaatggt
gggtgcccagagctggctggtgactggggtggggctggggatgccccgctatccccagat
ccactgctgccctcgccccctggctcccccaaggcagctcaactttcacccatcaccgag
ggggccccagaaatgccagcatcctctgagctcctgcctcccacccctgatatcccagta
gccatctccactgggggcccacccgaccacctgctccctcctctgggcactccactaccc
ccagactgggtgacattggagggggactttgtgcttatgttggccatctcacccagtcac
ctaggggctgacctggtggcagccccccacgcacgctttgacgacggcttggtgcacctg
tgttgggtgcgcagcggcatctcgcgggcagcactgctgcgcctttttctggccatggag
cacggcagccacttcagcctgggctgtccgcagctgggctatgccgcggctcgtgccttc
cgcctcgagcctctcacgccccgcggcgtgctgacagtggacggggagcaggtggagtat
gggccattgcaggcgcagatgcatccgggccttggtacactgctcactggtcctccgggg
tgccttgggcgggagccctga

DBGET integrated database retrieval system