KEGG   Sus scrofa (pig): 100738292Help
Entry
100738292         CDS       T01009                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ssc  Sus scrofa (pig)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ssc00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ssc04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:ssc04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:ssc04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ssc05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 646 aa AA seqDB search
MKTQRPDQELTWSWGHRPRSTLDRAKAMAPPPPLPLTASTPLLHGEFGSYPARGPRFALT
LTPQALHIQRLRPKPEARPRGGLVLLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGGR
RRAARTFRADEAATYEENRAEAQRWATALTCLLRGLPLPGDGDITPDLLPRPPRLLLLVN
PFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDGIVTVSGDG
LLYEVLNGLLDRPDWEEAVKTPVGILPCGSGNALAGAVNQHGGFEPALGIDLLLNCSLLL
CRGGGRPLDLLSVTLASGSRCFSFLSVAWGFISDVDIQSERFRALGSARFTLGTVLGLAT
LHTYRGRLSYLPATVEPASPTPAHGLPRAKSELTLAPAPAPPVAHSPLHRSVSDLPLPLP
LPTLTSPGSPEPLPVLSLNGGCPELAGDWGGAGDAPLSPDPLLPSPPGSPKAAQLSPITE
GAPEMPASSELLPPTPDIPVAISTGGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSH
LGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMEHGSHFSLGCPQLGYAAARAF
RLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCLGREP
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccagaggccagaccaggagctgacctggagctggggccacaggcctaggagc
accctggacagagctaaggccatggcccccccaccgccactgcccctgaccgccagcacc
ccactcctgcatggcgagtttggttcctacccagcccgaggcccacgctttgccctcact
ctcacaccacaagccctgcacatccagcggctgcgcccgaagcctgaagcccggccacgg
ggtggcctggtcctgctggccgaggtctcaggctgctgcaccctgcggagccggagcccc
tcagactcggcagcctacttctgcatctatacctacccgaggggccggcgcgggggccgg
cgcagagctgcacgtaccttccgagccgacgaggcagccacctatgaggagaaccgtgct
gaggcccagcgctgggccactgccctcacgtgtctgctccgcgggctgccgctgcctggg
gacggggacatcacccctgaccttctgcctcggccgccccgattgctcctactggtcaat
ccctttggggggcggggcctggcctggcagtggtgtaagaaccacgtgctgcccatgatc
tctgaagctgggctgtccttcaacctcatccagacagaacgacagaaccacgcccgggag
ctggtccaggggctgagcctgagcgagtgggacggcatcgtcacagtctcgggagatggg
ctgctgtacgaggtgctgaatggactcctagatcgccccgactgggaagaggctgtgaag
accccagtgggcatcctgccctgtggctctggcaacgcactggcaggagctgtgaaccag
catggggggtttgagccggccctgggcattgacctgctgctcaactgctctttgctgctc
tgccggggtggcggccgcccactggacctgctctcggtgacgctggcctccggctcccgc
tgtttctccttcctgtctgtggcatggggcttcatatcagacgtggatatccagagcgag
cgcttcagagccctgggcagtgctcgcttcacactgggcacagtgctgggactggctaca
ctgcacacctaccgcggccgcctctcctacctccctgccaccgtggaacctgcctcaccc
actcctgcccatggtctgccacgtgccaagtcagagttgaccctggccccggccccagcc
ccacccgtggcccactcacccctgcatcgctctgtgtctgacctgcccctgcccctgccc
ctgcctaccctaacctctcctggctcacctgaacccctacctgtcctgtccctcaatggt
gggtgcccagagctggctggtgactggggtggggctggggatgccccgctatccccagat
ccactgctgccctcgccccctggctcccccaaggcagctcaactttcacccatcaccgag
ggggccccagaaatgccagcatcctctgagctcctgcctcccacccctgatatcccagta
gccatctccactgggggcccacccgaccacctgctccctcctctgggcactccactaccc
ccagactgggtgacattggagggggactttgtgcttatgttggccatctcacccagtcac
ctaggggctgacctggtggcagccccccacgcacgctttgacgacggcttggtgcacctg
tgttgggtgcgcagcggcatctcgcgggcagcactgctgcgcctttttctggccatggag
cacggcagccacttcagcctgggctgtccgcagctgggctatgccgcggctcgtgccttc
cgcctcgagcctctcacgccccgcggcgtgctgacagtggacggggagcaggtggagtat
gggccattgcaggcgcagatgcatccgggccttggtacactgctcactggtcctccgggg
tgccttgggcgggagccctga

DBGET integrated database retrieval system