KEGG   Sus scrofa (pig): 100738360Help
Entry
100738360         CDS       T01009                                 

Gene name
PDIA2
Definition
(RefSeq) protein disulfide isomerase family A, member 2
  KO
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100738360 (PDIA2)
Chaperones and folding catalysts [BR:ssc03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100738360 (PDIA2)
Membrane trafficking [BR:ssc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100738360 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 530 aa AA seqDB search
HDVNPAGDVLLLLGASASRARGQGPGGPSEGPPDEEEEQEEEEVPEEDGILVLNRRTLGL
ALREHPALLVEFYAPWCGQCKALAPEYSKAAALLAAEAAKARLAKVDGPAEPELAEEFAV
TEYPTLKFFRDGNRTHPEEYTGPREAQGIAEWLRRRVGPSATQLEDEEGARVLMRAWDVV
VIGFFQDLQDKDVATFLAVAQDALDMAFGLTDRPQLFQKFGLTKDTVVLFKKYDEGRADF
PVDKELGLDQGDLSRFLLTHSMHLVTEFTPQTSPKIFAARIPNHLLLFINQTLAAHLERL
SGFREAAPRFRGQVLFVVVDVGANNDHVLQYFGLKAEEAPTLRFVNMETTKKYAPADKEP
VTATSVAAFCRAVLGGELKPYRLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFIKFY
APWCTHCKEMAPAWEALAEKYKDHEDIIIAELDATANELEAFPVHGFPTLKYFPAGPGRK
AIEYKGTRDLETFSKFLDSGGALPAEEPTEPPGQPFPETPENSTKPKDEL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
catgacgtcaatcctgctggggatgtactgctgctgctcggggcctcagcttccagggcc
aggggccaggggcccgggggaccctcagaggggccccccgatgaggaggaggagcaggag
gaggaggaggtccccgaggaggatgggatcttggtgctgaaccggcggaccctgggcctg
gccttgcgggagcaccctgccctgctggtggagttctatgccccgtggtgtgggcaatgc
aaggcgctggcccccgagtacagcaaggcggctgccctgctggcagcagaggcggccaag
gccaggctggccaaggtggatgggcccgcggaaccagagctggccgaggagtttgccgtg
acagagtaccccacgctcaagttcttccgcgacgggaaccgcacgcacccggaggaatac
actggcccacgggaggcccaaggcatcgctgagtggctgaggcggcgcgtggggcccagt
gccacgcagctggaggatgaggagggtgcccgcgtgctgatgcgtgcctgggacgtggtc
gtcataggcttcttccaggacttgcaggacaaggatgtggctaccttcctggctgtggcc
caggatgccctggacatggcttttggcctcacggaccggccacagctctttcagaagttc
ggcctcaccaaggacaccgtggtccttttcaagaagtacgacgagggccgggcagacttc
ccagtggacaaggagctgggcctggaccagggggatctgtcccgcttcctgctcacgcac
agcatgcatctggtcacggagttcaccccgcagacatcccctaagatctttgcggccaga
atccctaaccacttgctgctgttcatcaaccagacgctggccgctcacctggagcggctg
agcggcttccgggaggcggctccccgtttccgggggcaggtgctgtttgtggtggtggac
gtgggcgccaacaacgaccacgtgctccagtacttcggcctcaaggccgaggaggccccc
accctgcgtttcgtcaacatggagaccaccaagaagtacgcacctgcggacaaggagccg
gtcacggccacctcggttgcagccttctgccgcgcagtcctcggtggggagctcaagccc
tatcgcttgagccaggagattcccccagactgggaccagcggcccgtcaagaccctcgtg
ggcaagaatttcgagcaggtggcttttgatgaaaccaagaatgtgtttatcaagttctac
gccccatggtgcacccactgcaaggagatggccccggcctgggaggcgctggctgagaag
tacaaagaccatgaggacatcatcatcgctgagctggacgccacggccaacgagctggag
gccttccctgtgcatggcttccccaccctcaagtacttcccggcagggccaggtcggaag
gcaattgaatacaaaggcaccagggacctggaaactttctccaagtttctggacagtggg
ggtgcgctgcctgccgaggagcccacggagccacccggacagcccttcccggagacgcca
gaaaactccacgaagcccaaggacgagctgtag

DBGET integrated database retrieval system