KEGG   Sus scrofa (pig): 100738360Help
Entry
100738360         CDS       T01009                                 

Gene name
PDIA2
Definition
protein disulfide isomerase family A, member 2
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 524 aa AA seqDB search
MGPPAGGLEGSRLWGVGSMWPRLRWAPDACSLLDLTDSKVCRPWLGGSRGSGWGLGGRGH
SWPCPPDAPWCGQCKALAPEYSKAAALLAAEAAKARLAKVDGPAEPELAEEFAVTEYPTL
KFFRDGNRTHPEEYTGPREAQGIAEWLRRRVGPSATQLEDEEGARVLMRAWDVVVIGFFQ
DLQDKDVATFLAVAQDALDMAFGLTDRPQLFQKFGLTKDTVVLFKKYDEGRADFPVDKEL
GLDQGDLSRFLLTHSMHLVTEFTPQTSPKIFAARIPNHLLLFINQTLAAHLERLSGFREA
APRFRGQVLFVVVDVGANNDHVLQYFGLKAEEAPTLRFVNMETTKKYAPADKEPVTATSV
AAFCRAVLGGELKPYRLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFIKFYAPWCTH
CKEMAPAWEALAEKYKDHEDIIIAELDATANELEAFPVHGFPTLKYFPAGPGRKAIEYKG
TRDLETFSKFLDSGGALPAEEPTEPPGQPFPETPENSTKPKDEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggacccccagctggaggccttgaggggtcccgtctctggggcgtgggctccatgtgg
ccgaggctcaggtgggcccctgatgcttgctccttgctggacctgactgactccaaggtc
tgcaggccctggctgggcgggagcaggggctccggctggggtcttggaggccgggggcac
tcatggccctgtcccccagatgccccgtggtgtgggcaatgcaaggcgctggcccccgag
tacagcaaggcggctgccctgctggcagcagaggcggccaaggccaggctggccaaggtg
gatgggcccgcggaaccagagctggccgaggagtttgccgtgacagagtaccccacgctc
aagttcttccgcgacgggaaccgcacgcacccggaggaatacactggcccacgggaggcc
caaggcatcgctgagtggctgaggcggcgcgtggggcccagtgccacgcagctggaggat
gaggagggtgcccgcgtgctgatgcgtgcctgggacgtggtcgtcataggcttcttccag
gacttgcaggacaaggatgtggctaccttcctggctgtggcccaggatgccctggacatg
gcttttggcctcacggaccggccacagctctttcagaagttcggcctcaccaaggacacc
gtggtccttttcaagaagtacgacgagggccgggcagacttcccagtggacaaggagctg
ggcctggaccagggggatctgtcccgcttcctgctcacgcacagcatgcatctggtcacg
gagttcaccccgcagacatcccctaagatctttgcggccagaatccctaaccacttgctg
ctgttcatcaaccagacgctggccgctcacctggagcggctgagcggcttccgggaggcg
gctccccgtttccgggggcaggtgctgtttgtggtggtggacgtgggcgccaacaacgac
cacgtgctccagtacttcggcctcaaggccgaggaggcccccaccctgcgtttcgtcaac
atggagaccaccaagaagtacgcacctgcggacaaggagccggtcacggccacctcggtt
gcagccttctgccgcgcagtcctcggtggggagctcaagccctatcgcttgagccaggag
attcccccagactgggaccagcggcccgtcaagaccctcgtgggcaagaatttcgagcag
gtggcttttgatgaaaccaagaatgtgtttatcaagttctacgccccatggtgcacccac
tgcaaggagatggccccggcctgggaggcgctggctgagaagtacaaagaccatgaggac
atcatcatcgctgagctggacgccacggccaacgagctggaggccttccctgtgcatggc
ttccccaccctcaagtacttcccggcagggccaggtcggaaggcaattgaatacaaaggc
accagggacctggaaactttctccaagtttctggacagtgggggtgcgctgcctgccgag
gagcccacggagccacccggacagcccttcccggagacgccagaaaactccacgaagccc
aaggacgagctgtag

DBGET integrated database retrieval system