KEGG   Sus scrofa (pig): 100738578Help
Entry
100738578         CDS       T01009                                 

Definition
lysozyme-like protein 6-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100738578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 148 aa AA seqDB search
MTRPLLISLVSCLVAVSQASLINRCDLAKVLHQEDLDGFEGYSLSDWLCLAFVESEFNIT
KVNENTDGSFDYGIFQINSHYWCNDYRSHTENICQVECEELLSPNLLSIINCAKKIVSGA
GGMKNWVKWRLHCAGRPLSYWMTGCHLG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcccgctgctcatctccttggtcagctgcctggttgctgtcagtcaagccagc
ctcatcaaccgctgtgacctggccaaggtgctgcaccaggaggacctggatggctttgag
ggctactccctgagcgattggctgtgcctggctttcgtggaaagtgaattcaatataaca
aaggtaaatgaaaatacagacggcagctttgactatggcatcttccagatcaacagccac
tactggtgcaacgattaccggagtcacacggagaacatttgccaagtagaatgtgaagaa
ctgctgagccccaatcttctctcaatcatcaactgtgcaaaaaagattgtgtctggagca
ggagggatgaagaactgggtaaagtggaggttgcactgtgcaggccggccactctcctac
tggatgacagggtgccacttgggatga

DBGET integrated database retrieval system