KEGG   Sus scrofa (pig): 100738771Help
Entry
100738771         CDS       T01009                                 

Definition
glycogen debranching enzyme-like
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ssc  Sus scrofa (pig)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssc00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 222 aa AA seqDB search
MREVAKGKVVRVSYDEWNRKIQDHFEKFFYVSEDPSDVNEKHPNLVHKRGVYKDSYGASS
PWCDYQLRPNFTIAMVVAPELFTIERAWKALEIAEKKLLGPLGMKTLDPDDMVYCGTYDN
ALDNDNYNLAKGFNYHQGPEWLWPVGYFLRAKLYFSKLMGPEATAKTIFLVKNVLSRHYV
HLERSPWKGLPELTNENGQYCPFSCETQAWSIATILETLHDL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagtagcaaaaggaaaggttgtgagagtctcatatgatgagtggaacagaaaa
atacaagaccacttcgaaaagttcttttatgtgtcggaagacccttcagatgtcaatgaa
aagcatcccaatctggtgcacaaacgcggcgtgtacaaagatagctatggagcttcaagc
ccttggtgcgactaccagctcaggcctaattttaccatagcaatggttgtggccccagag
ctctttactattgaaagagcatggaaggctttggagattgcagaaaaaaagttgcttggt
cctcttggcatgaaaactttggatccagatgatatggtttactgtggaacttatgacaat
gccttagacaatgacaactacaatcttgctaaaggtttcaattatcaccaaggacctgag
tggctgtggcccgttggatattttcttcgtgcgaaattatatttttccaaattgatgggt
ccagaggctactgcaaagactatatttttggttaaaaatgttctttctcgacattatgtt
catctagagcgatccccttggaaaggacttccagaactgaccaacgagaatggacaatac
tgtcctttcagctgtgaaacacaagcctggtcaattgccactattcttgaaacactccat
gacttatag

DBGET integrated database retrieval system