KEGG   Sus scrofa (pig): 100738771Help
Entry
100738771         CDS       T01009                                 

Definition
(RefSeq) glycogen debranching enzyme-like
  KO
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ssc  Sus scrofa (pig)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100738771
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100738771
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     100738771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 148 aa AA seqDB search
MVVAPELFTIERAWKALEIAEKKLLGPLGMKTLDPDDMVYCGTYDNALDNDNYNLAKGFN
YHQGPEWLWPVGYFLRAKLYFSKLMGPEATAKTIFLVKNVLSRHYVHLERSPWKGLPELT
NENGQYCPFSCETQAWSIATILETLHDL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggttgtggccccagagctctttactattgaaagagcatggaaggctttggagattgca
gaaaaaaagttgcttggtcctcttggcatgaaaactttggatccagatgatatggtttac
tgtggaacttatgacaatgccttagacaatgacaactacaatcttgctaaaggtttcaat
tatcaccaaggacctgagtggctgtggcccgttggatattttcttcgtgcgaaattatat
ttttccaaattgatgggtccagaggctactgcaaagactatatttttggttaaaaatgtt
ctttctcgacattatgttcatctagagcgatccccttggaaaggacttccagaactgacc
aacgagaatggacaatactgtcctttcagctgtgaaacacaagcctggtcaattgccact
attcttgaaacactccatgacttatag

DBGET integrated database retrieval system