KEGG   Sus scrofa (pig): 100739107Help
Entry
100739107         CDS       T01009                                 

Gene name
DYRK3
Definition
(RefSeq) LOW QUALITY PROTEIN: dual specificity tyrosine-phosphorylation-regulated kinase 3
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100739107 (DYRK3)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100739107 (DYRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
9
AA seq 587 aa AA seqDB search
MGGTARGPGRKDAGQPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNALCNPXEPPLPR
RLNIPTEHLTRDHTQRFLNGGEMKVEQLFQEFGNRRSSTFQSNGINDSEKCSPTTSQGQS
SDSLNTVKSSSSSKTSRVVPLTPEQALKQYKHHLTAYEKLEIVNYPEIYFVGPNAKKRHG
VVGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSIQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGLPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWVTALKGCDDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSVPRPLTIEKVSGKRV
VNPANAFQGLGSKLPPVVGIASKLTANLMSETSSGIPLSSVLPKLIS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcaccgctcgcgggcccgggcgaaaggatgcggggcagccgggagctggactc
ccgccccagcagcggagattgggggatggtgtctatgataccttcatgatgatagatgaa
accaaatgcccaccctgttcaaatgcactctgcaatcctnctgaaccgcctctacccaga
agactgaatatccctactgagcatttaacaagagatcatacccagcgctttctgaatgga
ggtgagatgaaggtagaacagctatttcaagaatttggcaaccgaagatccagtactttt
cagtccaatggcatcaacgactctgaaaaatgttctcctaccacttctcagggtcaaagt
tcggatagcttgaatacggtaaaatccagcagttcatcgaaaacatccagagtggtgccc
ctgactccagaacaagcgctgaagcaatataaacaccacctgactgcttatgagaagctg
gaaatcgtcaattacccagaaatttacttcgtgggtccaaatgcaaaaaaaagacatggt
gtggtcggtggtcccaataatggggggtacgatgatgcagatggggcctatatccatgtg
cctcgagaccacctagcttatcgatacgaggtgctcaaaatcattggcaagggcagcttt
gggcaggtagcccgggtctatgaccacaaacttcgccagtacgtggccctgaagatggtg
cgcaatgaaaagcgctttcatcgtcaagctgccgaggagatccggattttggagcatctt
aagaagcaggataaaacgggcagcatgaacgtcattcacatgctggaaagtttcacattc
cggaaccacgtttgcatggcctttgaattgctgagcatagacctctacgagctcattaaa
aaaaacaagttccagggtttcagcatccagctcgtacgcaagtttgcccagtccatcttg
cagtccctggatgctctccacaaaaataagatcattcactgtgacctgaagccagaaaac
attctcctgaaacaccacgggcgcagcgcgaccaaggtcattgacttcgggtccagctgt
ttcgagtaccagaagctttacacgtatatccagtctcggttctacagagctcccgagatc
atcctgggaagccgctatagcacgcccattgacatatggagttttggctgtatcttggca
gaacttttaacagggcagcctctcttccctggagaggatgaaggagaccagctggcctgt
atgatggagcttctagggatgcctccaccaaagctcctggagcagtccaaacgtgccaag
tacttcattaactccaagggcctacctcgctactgttctgtgaccactcaggcagatggg
agggttgtgcttgtcgggggtcgttcgcggaggggtaagaagcggggccccccaggcagc
aaagactgggtgacagctctgaaagggtgtgatgactacttatttatagagtttctgaaa
aggtgtcttcagtgggacccctctgcccgcctgaccccagctcaagcattaagacaccct
tggattagcaagtctgtgcccagacctctcaccattgaaaaggtgtcaggcaaacgggta
gtaaatcctgcaaatgctttccagggtctgggctccaagctgcctccagttgtaggaata
gccagtaagcttacagctaacttaatgtcagaaaccagcagtggtatacctctgagcagt
gtcttgccaaaactgattagctag

DBGET integrated database retrieval system