KEGG   Sus scrofa (pig): 100739496Help
Entry
100739496         CDS       T01009                                 

Definition
laminin subunit gamma-3-like
Orthology
K06247  
laminin, gamma 3
Organism
ssc  Sus scrofa (pig)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:ssc04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:ssc04510]
Human Diseases; Cancers; Pathways in cancer [PATH:ssc05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:ssc05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ssc05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ssc05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 875 aa AA seqDB search
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAEASHTCGHPPED
FCPHVGAQGAGAQCQRCDAADPERHHNASYLTDFHSQDDSTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASCRKTYGKAEGQYLR
PGEDERAAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDEEGQLACRCQHNTTGPD
CERCLPFFQDRPWARGTAEAANECLPCNCSGHSEECIFDRELFRTSGHGGRCLHCRDHTA
GPHCERCQENFYRWNPQMPCQPCDCHPAGSLHLQCDDSGTCKCKPTVTGWKCDRCQPGFH
SLSEGGCRPCTCNSAGSLGTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSC
FCYGHSKACAAATQFRTHHILADFRQGADGWRAGSSGGPAHPARWSPGGLLLDPEDEEEL
RAPEKFLGDQRFSYGQPLTLTFRVPPGGAPLPVQLRLEGTGLALTLRHSSSSSPRDAGQQ
EEVQLRFQLQETSEDADPPLPPFHFQRLLANLTALRIRTSGWSPSPSGRVLLTEVRLTSA
QPGLGPPASWVETCSCPSGYSGQFCESCAPGYKRETPLGGPYASCVPCICNQHGTCDPNT
GICLCGHHTEGPSCERCLPGFYGNPFTGQADDCQPCPCPGQSACTTMPESGEVVCTHCPP
GQRGQRCEICDDGFFGDPLGLSGAPQPCRPCQCSGNVDPNAVGNCDPLTGHCLRCLHNTT
GAHCERCQEGFYGDALASLPEDKCVREYPPPGPTR
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccgcgctcctgctgggcttggcgctcctggcgccgcgggcggccggcgcg
ggcatgggcgcgtgttacgacggcgcggggcgcccgcagcgctgcctgcccgtgttcgag
aacgcggcgttcggccggctcgccgaagcctcgcacacgtgcggccacccgcccgaggac
ttctgcccgcacgtgggcgcccagggcgcgggggcgcagtgccagcgctgcgacgccgcc
gaccccgagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgacagc
acctggtggcagagcccgtccatggccttcggggtacagtaccccacctcggtcaacata
acccttcgcttgggaaaagcttacgagatcacctacgtgcggctgaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgggccggcggcccctgggagccctac
cagtactacagcgcctcctgccggaagacctacggcaaggccgagggccagtacctgcgc
cccggcgaggacgagcgcgcggccttctgcacctccgagttcagcgacatctccccgctg
agcggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaactttgag
gagagccccgtgttgcaggagtgggtcaccagcacggagcttcttatctccctggaccgg
ctcaacacgtttggggacgacatcttcaaggaccctaaggtgctgcagtcctactactat
gccgtgtcggacttctctgtgggcggcagatgcaagtgcaacggccacgccagcgagtgt
ggcccggatgaggagggccagctggcctgccggtgccagcacaacaccacgggcccagac
tgtgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcacagctgaggcc
gccaacgagtgtctgccttgcaactgcagcggccactctgaggaatgcatatttgaccgg
gagctcttccgcacctcgggccacggtgggcgctgccttcactgccgtgaccacacagct
gggccgcactgcgagcgctgccaggagaacttctatcgctggaacccgcagatgccgtgc
cagccctgtgattgccacccagcaggctccctgcacctccagtgtgatgactcgggcacc
tgcaagtgcaagcccacggtgacaggctggaagtgtgatcgctgccagcccgggttccac
tcgctcagcgagggtggctgcagaccctgtacttgcaattctgctggcagcctgggcacc
tgtgaccctcgcagcgggcgctgcccttgcaaagagaatgtggaaggaaacctttgtgac
aggtgtcgcccgggtacatttaacctgcagccccacaacccagcgggctgcagcagctgc
ttctgctacggccactccaaggcgtgtgcggctgccacccagttccggacgcaccacatc
ctcgccgacttccgccagggagccgatggctggcgggccggaagctcggggggcccagcg
catcctgcacgatggagccccggggggctcctcctggacccggaggatgaagaggagctc
agagcaccagagaagttcctgggagaccagcggttcagctacgggcagcccctcacactg
acctttcgggtcccccccgggggcgcccctctcccagtgcagctgaggctggaagggact
ggcttggccctgactctgcggcactccagctcgtccagcccccgggacgccgggcagcag
gaggaggtacagctcaggttccagttgcaggagacctccgaggacgcggaccctccgctg
ccccccttccacttccagcggctgctggccaatctgacggctctgcgtatccggaccagt
ggctggagccccagcccttctggccgagtgttgctgaccgaggtccggctcacgtctgcc
cagccagggctcggccccccagcctcctgggtagagacgtgctcgtgtccctcggggtac
tcaggccagttctgtgaatcctgtgctccgggatacaagcgggagacaccactggggggt
ccctatgccagctgtgttccctgcatctgtaaccagcatggcacctgtgaccccaacaca
gggatctgcctgtgcggccaccacaccgagggcccttcctgtgagcgctgcttgccaggt
ttctatggcaaccccttcacgggccaagccgatgactgccagccctgtccctgtcctggg
cagtcggcctgcacgaccatgccagagagtggggaggtggtgtgtacccactgccccccg
ggccagagagggcaacgctgtgagatctgcgatgatggcttttttggggacccactgggg
ctctctggagccccccagccctgccggccatgtcagtgcagtgggaacgtggaccccaac
gctgtgggcaactgtgaccccctgactggccactgcctgcgatgtctgcacaacacgaca
ggtgcccactgtgagcggtgccaggagggcttctacggggacgccctggcctctctgccc
gaggacaaatgcgtgcgtgagtacccacctcctggacccacgaggtga

DBGET integrated database retrieval system