KEGG   Sus scrofa (pig): 100739496Help
Entry
100739496         CDS       T01009                                 

Definition
laminin subunit gamma-3-like
Orthology
K06247  
laminin, gamma 3
Organism
ssc  Sus scrofa (pig)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100739496
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100739496
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100739496
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100739496
   05222 Small cell lung cancer
    100739496
  Infectious diseases
   05146 Amoebiasis
    100739496
   05145 Toxoplasmosis
    100739496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 875 aa AA seqDB search
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAEASHTCGHPPED
FCPHVGAQGAGAQCQRCDAADPERHHNASYLTDFHSQDDSTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASCRKTYGKAEGQYLR
PGEDERAAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDEEGQLACRCQHNTTGPD
CERCLPFFQDRPWARGTAEAANECLPCNCSGHSEECIFDRELFRTSGHGGRCLHCRDHTA
GPHCERCQENFYRWNPQMPCQPCDCHPAGSLHLQCDDSGTCKCKPTVTGWKCDRCQPGFH
SLSEGGCRPCTCNSAGSLGTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSC
FCYGHSKACAAATQFRTHHILADFRQGADGWRAGSSGGPAHPARWSPGGLLLDPEDEEEL
RAPEKFLGDQRFSYGQPLTLTFRVPPGGAPLPVQLRLEGTGLALTLRHSSSSSPRDAGQQ
EEVQLRFQLQETSEDADPPLPPFHFQRLLANLTALRIRTSGWSPSPSGRVLLTEVRLTSA
QPGLGPPASWVETCSCPSGYSGQFCESCAPGYKRETPLGGPYASCVPCICNQHGTCDPNT
GICLCGHHTEGPSCERCLPGFYGNPFTGQADDCQPCPCPGQSACTTMPESGEVVCTHCPP
GQRGQRCEICDDGFFGDPLGLSGAPQPCRPCQCSGNVDPNAVGNCDPLTGHCLRCLHNTT
GAHCERCQEGFYGDALASLPEDKCVREYPPPGPTR
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccgcgctcctgctgggcttggcgctcctggcgccgcgggcggccggcgcg
ggcatgggcgcgtgttacgacggcgcggggcgcccgcagcgctgcctgcccgtgttcgag
aacgcggcgttcggccggctcgccgaagcctcgcacacgtgcggccacccgcccgaggac
ttctgcccgcacgtgggcgcccagggcgcgggggcgcagtgccagcgctgcgacgccgcc
gaccccgagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgacagc
acctggtggcagagcccgtccatggccttcggggtacagtaccccacctcggtcaacata
acccttcgcttgggaaaagcttacgagatcacctacgtgcggctgaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgggccggcggcccctgggagccctac
cagtactacagcgcctcctgccggaagacctacggcaaggccgagggccagtacctgcgc
cccggcgaggacgagcgcgcggccttctgcacctccgagttcagcgacatctccccgctg
agcggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaactttgag
gagagccccgtgttgcaggagtgggtcaccagcacggagcttcttatctccctggaccgg
ctcaacacgtttggggacgacatcttcaaggaccctaaggtgctgcagtcctactactat
gccgtgtcggacttctctgtgggcggcagatgcaagtgcaacggccacgccagcgagtgt
ggcccggatgaggagggccagctggcctgccggtgccagcacaacaccacgggcccagac
tgtgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcacagctgaggcc
gccaacgagtgtctgccttgcaactgcagcggccactctgaggaatgcatatttgaccgg
gagctcttccgcacctcgggccacggtgggcgctgccttcactgccgtgaccacacagct
gggccgcactgcgagcgctgccaggagaacttctatcgctggaacccgcagatgccgtgc
cagccctgtgattgccacccagcaggctccctgcacctccagtgtgatgactcgggcacc
tgcaagtgcaagcccacggtgacaggctggaagtgtgatcgctgccagcccgggttccac
tcgctcagcgagggtggctgcagaccctgtacttgcaattctgctggcagcctgggcacc
tgtgaccctcgcagcgggcgctgcccttgcaaagagaatgtggaaggaaacctttgtgac
aggtgtcgcccgggtacatttaacctgcagccccacaacccagcgggctgcagcagctgc
ttctgctacggccactccaaggcgtgtgcggctgccacccagttccggacgcaccacatc
ctcgccgacttccgccagggagccgatggctggcgggccggaagctcggggggcccagcg
catcctgcacgatggagccccggggggctcctcctggacccggaggatgaagaggagctc
agagcaccagagaagttcctgggagaccagcggttcagctacgggcagcccctcacactg
acctttcgggtcccccccgggggcgcccctctcccagtgcagctgaggctggaagggact
ggcttggccctgactctgcggcactccagctcgtccagcccccgggacgccgggcagcag
gaggaggtacagctcaggttccagttgcaggagacctccgaggacgcggaccctccgctg
ccccccttccacttccagcggctgctggccaatctgacggctctgcgtatccggaccagt
ggctggagccccagcccttctggccgagtgttgctgaccgaggtccggctcacgtctgcc
cagccagggctcggccccccagcctcctgggtagagacgtgctcgtgtccctcggggtac
tcaggccagttctgtgaatcctgtgctccgggatacaagcgggagacaccactggggggt
ccctatgccagctgtgttccctgcatctgtaaccagcatggcacctgtgaccccaacaca
gggatctgcctgtgcggccaccacaccgagggcccttcctgtgagcgctgcttgccaggt
ttctatggcaaccccttcacgggccaagccgatgactgccagccctgtccctgtcctggg
cagtcggcctgcacgaccatgccagagagtggggaggtggtgtgtacccactgccccccg
ggccagagagggcaacgctgtgagatctgcgatgatggcttttttggggacccactgggg
ctctctggagccccccagccctgccggccatgtcagtgcagtgggaacgtggaccccaac
gctgtgggcaactgtgaccccctgactggccactgcctgcgatgtctgcacaacacgaca
ggtgcccactgtgagcggtgccaggagggcttctacggggacgccctggcctctctgccc
gaggacaaatgcgtgcgtgagtacccacctcctggacccacgaggtga

DBGET integrated database retrieval system