KEGG   Sus scrofa (pig): 102163263Help
Entry
102163263         CDS       T01009                                 

Definition
uncharacterized LOC102163263
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ssc  Sus scrofa (pig)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102163263
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102163263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 228 aa AA seqDB search
MCPAYVMERKGVASCCVTSTSRSARGKLHGGSNFSKGQYLTFIISLVQVGKDSFGNDYIE
NLKQNDISTEFTYQTEDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLREAASTISRA
KVMICQLEVTPATSLEALTIAHSNGGSLTRAGLWVGPSNASAVTCQAVLPVEELADLGHQ
EWAGVGEGGQRPPRPLPFFLRAGMPKYECCMIYPDPQGDEEKNISGKI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccagcttacgtcatggaacggaaaggggtggcgtcctgctgcgtcacgtcgacg
tcacgcagcgcacgagggaagttacacgggggaagcaatttctccaaggggcaatatcta
acattcatcatttctttggtacaggttggcaaagattcctttggcaatgattatatagaa
aacttaaaacagaatgatatttctacagaatttacatatcagacggaagatgctgcgaca
ggaactgcttcaataattgtcaataatgaaggccagaatatcatcgttatagtggctgga
gcaaatttacttttgaatactgaagacctgagggaagcagccagtaccatcagcagagcc
aaagtaatgatctgccagctagaagtaactccagcaacttctttggaagccctgacaata
gcccacagcaatggaggcagcctgactcgggctggcctctgggtggggcccagcaatgct
tccgctgtcacctgccaggccgttcttccggttgaggagctagcggacctggggcatcag
gaatgggcgggggtaggtgaaggtgggcaaagaccacctcgcccactcccatttttcctg
agagctggcatgcctaagtatgaatgctgcatgatctatccggacccccagggcgacgag
gagaagaatatcagcgggaagatctaa

DBGET integrated database retrieval system