KEGG   Sus scrofa (pig): 396595Help
Entry
396595            CDS       T01009                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
ssc  Sus scrofa (pig)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    396595 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    396595 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    396595 (PRF1)
   05330 Allograft rejection
    396595 (PRF1)
   05332 Graft-versus-host disease
    396595 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    396595 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    396595 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 555 aa AA seqDB search
MASPVLLLSILLLLLPTPAPAPCYTAARSECRRKLKFVPGAWLAGEGMDVTSLQRSRSFP
VDTQHYLRPDGTCTLCQNALQGGVLQRLPLALTSWRAQGTSCKRKVLREEGRSTEEVAKE
AASNIRNDWRVGLDVTPKPSTNVQVTVAGSHSQAANFAAQKTHQDQYRFSLDSVECRFYS
FHLVHTPPLHPEFKKALRTLPPHFNTSTEPDYLRLISSYGTHFIQSMDLGGRITALTALR
TCELALEGLTSKEVEDCLSVEAEVSISGRASSSAAYKACEDKKKQHKMGSSFHQAYRERH
SEVLGGHHTFTHDLLFGNQAGPEQFSAWVASLPDSPDLVDYTLEPLHVLLESQDPRREAL
RQAVSKYVTDRARWKDCSRPCPPGQRKSPQDPCQCVCHGSSATNQDCCPRQRGLARLVVM
NFVATGLWGDYFTATDAYLKVFFGGQELRTSTMWNNNHPQWMIHLDFGDVLLSTGGPLRV
QVWDADYGWDDDLLGTCDRTPQSGSHEVMCALNHGHLKFSYHAKCLPHLTGGKCLEYAPP
GLLGEPLGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccagtgctcctcctcagcatcctcctcctgctgctgcccacgcccgccccc
gccccctgctacacggctgcgcgctctgagtgccgacgcaaactcaagttcgtgccaggc
gcctggctggcgggggagggcatggatgtgaccagcctccagcgttcacgctcctttccg
gtggacacacagcactacctgcgacctgacggcacctgcaccctctgccaaaatgctctg
caggggggcgttctccagcgcctgcccctggcgctcaccagctggcgcgcccagggcacc
agctgcaagcgcaaagtgctcagagaagagggccgctccaccgaggaggtggctaaggag
gcagccagcaatatccgcaacgactggcgggtagggctggacgtgactcccaagcccagc
accaatgtgcaggtgaccgtggcgggctcccactcccaggcagccaacttcgcggcccag
aagactcaccaggaccagtaccgcttcagcctggactcagtggagtgtcgcttctacagt
tttcacctggtgcacacgcccccgctccaccctgagttcaagaaggccctcaggacgctg
cccccccacttcaacacctccaccgagcccgactacctgaggctcatctccagctacggc
acccacttcatccagtccatggacctgggtggccgcatcacggccctcactgccctgcgc
acctgcgagctggccctggaagggctcacatccaaggaggtggaggactgcttgtccgtc
gaagctgaggtcagcataagtggccgagccagctcctcggcggcgtacaaggcgtgtgag
gacaagaagaagcagcacaagatggggtcctccttccaccaggcctaccgggaacgccat
tctgaagtccttgggggccaccacacgttcacacacgacctgttgttcgggaaccaggct
gggcctgagcagttctcggcctgggtggcctcattgccggacagccccgacctggtggac
tacacactggagcccctgcacgtgctgctggagagccaggacccgcgtcgggaggcactc
cggcaggcggtgagcaagtatgtgacggacagggcgcgctggaaggactgcagccgcccg
tgccccccgggacagcggaagagcccccaggacccatgccagtgcgtgtgccatggctca
tcggccaccaatcaggactgctgtccccggcagaggggcctggcccggctggtggtcatg
aacttcgtggcgacggggctgtggggagactatttcactgccacggacgcctatctgaag
gtcttctttggtggccaggagctgcggaccagcaccatgtggaacaataaccatccccag
tggatgatacatctggacttcggggatgtgctcctgtccacgggggggcccctgagggta
caggtctgggacgcggactatggctgggacgatgaccttcttggcacctgcgaccggaca
ccacagtctggctcacacgaggtgatgtgcgccttgaaccatggccacctgaaattctcc
taccatgccaagtgcttgcctcacctgaccggggggaagtgcctggagtacgcccccccg
gggcttctgggggagcctctgggaaaccggagcggggcagtgtggtga

DBGET integrated database retrieval system