KEGG   Sus scrofa (pig): 396637Help
Entry
396637            CDS       T01009                                 

Gene name
UCHL1, UCH-L1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    396637 (UCHL1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     396637 (UCHL1)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   396637 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLTRLGVAGHWRFADVLGLEEESLGSVPAPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaaaccgatggagattaacccggagatgctgaacaaagtgctgacaaggctc
ggggtcgccggccattggcgcttcgcggacgtgctgggactggaggaggagtctttgggc
tcggtgccagcacctgcttgcgcgctgctgctgctctttcccctcacggcccagcatgag
aacttcaggaaaaaacagattgaagagctgaagggacaagaagtcagtcctaaggtgtac
tttatgaagcagaccattggcaactcctgtggcaccatcgggcttatacatgcagtagcc
aataatcaggacaaactggagtttgaggatggatcggttctgaaacagtttctttctgaa
acagagaagttgtctccggaagacagagcaaaatgctttgaaaagaatgaggctatccag
gctgcccatgatgctgtggcccaggagggacagtgccgggtagatgacaaagtgaacttt
cattttattctgtttaacaacgtggatggccacctctatgaacttgatggtcggatgcct
tttccggtgaaccatggcgccagctcagaggactcgctgctgcaggacgccgccaaggtc
tgcagagaattcactgagcgtgagcaaggcgaggtccgcttctcggccgtggcgctctgc
aaggcggcctaa

DBGET integrated database retrieval system