KEGG   Sus scrofa (pig): 396710Help
Entry
396710            CDS       T01009                                 

Definition
retinoic acid receptor beta
Orthology
K08528  
retinoic acid receptor beta
Organism
ssc  Sus scrofa (pig)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    396710
   05222 Small cell lung cancer
    396710
   05223 Non-small cell lung cancer
    396710
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    396710
Nuclear receptors [BR:ssc03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   396710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 448 aa AA seqDB search
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFASQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRRRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagcccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcgattgaaacacagagcaccagc
tccgaggaactggtcccaagccctccgtctccacttcctccgcctcgtgtgtacaaaccc
tgcttcgtctgccaggacaagtcatcgggctaccactatggggtcagcgcctgtgagggc
tgtaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatccgtcaggaatgacaggaacaagaaaaagaag
gagccttcgaagcaggaatgcacagagagctacgaaatgacagccgagctggacgacctc
acagagaagatccgaaaagctcaccaggaaaccttcccctctctctgccagctgggcaag
tacaccacgaattccagtgctgaccatcgagtccgactggacctgggcctctgggacaaa
ttcagtgagctggccaccaagtgcattattaagatcgtggagtttgctaaacgtctgcca
ggcttcaccggcttgaccatcgcagaccaaatcaccctgctgaaggccgcctgcctggac
atcctgatccttagaatctgcaccaggtataccccggagcaggacaccatgacgttctca
gatggcctgaccctgaaccgaacccagatgcacaatgccgggttcggccccctgaccgac
cttgtgttcaccttcgccagccagctcctgcccttggagatggatgacacagagacgggc
cttctcagcgccatctgcttgatctgtggagaccgccaggaccttgaagaaccaacaaaa
gtagataaactacaagaaccactgctggaagcactaaaaatttatatcagaaggagacga
cccagcaagcctcacatgttcccaaagatcttaatgaagattacagatctccgcagcatc
agtgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttgaccccaagctca
agtgggaacacagccgagcacagccccagcatctcacccagctcagtggagaacagcggt
gtcagtcagtcaccactggtgcagtag

DBGET integrated database retrieval system