KEGG   Sus scrofa (pig): 396710Help
Entry
396710            CDS       T01009                                 

Definition
(RefSeq) retinoic acid receptor beta
  KO
K08528  
retinoic acid receptor beta
Organism
ssc  Sus scrofa (pig)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    396710
   05222 Small cell lung cancer
    396710
   05223 Non-small cell lung cancer
    396710
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    396710
Nuclear receptors [BR:ssc03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   396710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 448 aa AA seqDB search
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFASQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRRRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagcccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcgattgaaacacagagcaccagc
tccgaggaactggtcccaagccctccgtctccacttcctccgcctcgtgtgtacaaaccc
tgcttcgtctgccaggacaagtcatcgggctaccactatggggtcagcgcctgtgagggc
tgtaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatccgtcaggaatgacaggaacaagaaaaagaag
gagccttcgaagcaggaatgcacagagagctacgaaatgacagccgagctggacgacctc
acagagaagatccgaaaagctcaccaggaaaccttcccctctctctgccagctgggcaag
tacaccacgaattccagtgctgaccatcgagtccgactggacctgggcctctgggacaaa
ttcagtgagctggccaccaagtgcattattaagatcgtggagtttgctaaacgtctgcca
ggcttcaccggcttgaccatcgcagaccaaatcaccctgctgaaggccgcctgcctggac
atcctgatccttagaatctgcaccaggtataccccggagcaggacaccatgacgttctca
gatggcctgaccctgaaccgaacccagatgcacaatgccgggttcggccccctgaccgac
cttgtgttcaccttcgccagccagctcctgcccttggagatggatgacacagagacgggc
cttctcagcgccatctgcttgatctgtggagaccgccaggaccttgaagaaccaacaaaa
gtagataaactacaagaaccactgctggaagcactaaaaatttatatcagaaggagacga
cccagcaagcctcacatgttcccaaagatcttaatgaagattacagatctccgcagcatc
agtgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttgaccccaagctca
agtgggaacacagccgagcacagccccagcatctcacccagctcagtggagaacagcggt
gtcagtcagtcaccactggtgcagtag

DBGET integrated database retrieval system