KEGG   Sus scrofa (pig): 396710Help
Entry
396710            CDS       T01009                                 

Gene name
RARB
Definition
(RefSeq) LOW QUALITY PROTEIN: retinoic acid receptor beta
  KO
K08528  
retinoic acid receptor beta
Organism
ssc  Sus scrofa (pig)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    396710 (RARB)
   05222 Small cell lung cancer
    396710 (RARB)
   05223 Non-small cell lung cancer
    396710 (RARB)
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    396710 (RARB)
Nuclear receptors [BR:ssc03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   396710 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
13
AA seq 336 aa AA seqDB search
MIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYE
MTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKI
VEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHN
AGFGPLTDLVFTFASQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEAL
KIYIRRRRPSKPHMFXKDLNEITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
HEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaatcga
tgccagtactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatccgtcagg
aatgacaggaacaagaaaaagaaggagccttcgaagcaggaatgcacagagagctacgaa
atgacagccgagctggacgacctcacagagaagatccgaaaagctcaccaggaaaccttc
ccctctctctgccagctgggcaagtacaccacgaattccagtgctgaccatcgagtccga
ctggacctgggcctctgggacaaattcagtgagctggccaccaagtgcattattaagatc
gtggagtttgctaaacgtctgccaggcttcaccggcttgaccatcgcagaccaaatcacc
ctgctgaaggccgcctgcctggacatcctgatccttagaatctgcaccaggtataccccg
gagcaggacaccatgacgttctcagatggcctgaccctgaaccgaacccagatgcacaat
gccgggttcggccccctgaccgaccttgtgttcaccttcgccagccagctcctgcccttg
gagatggatgacacagagacgggccttctcagcgccatctgcttgatctgtggagaccgc
caggaccttgaagaaccaacaaaagtagataaactacaagaaccactgctggaagcactg
aaaatttatatcagaaggagacgacccagcaagcctcacatgttcnncaaagatcttaat
gaaattacagatctccgcagcatcagtgctaaaggtgcagaacgtgtaattaccttgaaa
atggaaattcctggatcaatgccacctctcattcaggaaatgctggagaattctgaagga
catgaacccttgaccccaagctcaagtgggaacacagccgagcacagccccagcatctca
cccagctcagtggagaacagcggtgtcagtcagtcaccactggtgcagtag

DBGET integrated database retrieval system