KEGG   Sus scrofa (pig): 396713Help
Entry
396713            CDS       T01009                                 

Gene name
A
Definition
blood group A transferase-like
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    396713 (A)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     396713 (A)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     396713 (A)
Glycosyltransferases [BR:ssc01003]
 Glycan extension
  ABO blood group
   396713 (A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MDPRDFWGKSAKLWLCPILLFVACLGFYSNVFSLTPGWQSKESQSPEPQQLQESSLQPES
LPLSECDCHLDTCRIPEVPRLIYPKAQVLKPTRVDVLVMTPWFAPIIWDGTFDSAVLDAQ
FRNTTIGLTVFAIKKYVVFLKLFLETAEKYFMVGHRVNYYIFTDRPADVPQVPLGEGRQV
VVLEVRNYSRWQDISMHRMEMIRNFSQQRFLHEVDYLVCVDVDMKFSDHVGVEILAPLFG
TLHPGFYAAPRQSFTYERRPLSQAYIPRDEGDFYYAGGFFGGSVPEVQRLTTACHQAMVA
DKAKGIEAVWHDESHLNRYLLYHKPSKVLSPEYLWDEHMLQRPPFLRKLRYVAVPKNHAE
IRNR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggacccccgagatttctggggaaagagtgccaagctctggctgtgccccattctgctc
tttgttgcctgtcttggcttctacagcaatgttttcagcctgactcccgggtggcagagc
aaagagtctcaaagccccgagccccagcagctgcaggagagctctctccaaccagagagc
ctgcccttgagtgaatgtgactgccacctggacacctgcaggatacccgaagtacccagg
ttgatttaccccaaggcccaggtcctcaaacccacgagagtggacgtgctggtcatgact
ccctggtttgctcccatcatctgggatgggacctttgattctgctgtcctggatgcacag
ttcagaaacaccaccattggcctgaccgtgtttgccatcaaaaaatacgtggtcttcctg
aagctgttcctggagacagcggagaaatacttcatggtgggacacagggtcaactactac
atcttcaccgaccggccagctgacgtgccccaggtccccctcggggaagggaggcaggtg
gtggtccttgaggtccggaactacagtcgctggcaggacatatccatgcaccgaatggag
atgatccgcaacttctcccagcagcgcttcctccacgaggtggactacctcgtgtgcgtg
gatgtggacatgaagttcagcgaccacgtgggcgtggagatcctggcccccctcttcgga
accctgcaccccggtttctacgcagctccccgccagtccttcacctacgaacgccggccc
ctgtctcaggcttacattccgagagatgagggcgacttttactacgcaggaggctttttt
ggggggtcagtccctgaggtgcagcggctcaccaccgcgtgtcaccaggccatggtggct
gacaaggccaagggcatcgaggctgtgtggcatgatgagagccacctgaacaggtacctg
ctgtaccacaagcccagcaaggtgctgtccccggagtacctatgggacgagcacatgctg
cagagaccccccttcctcaggaaactgcgctacgtggcggtgcccaagaatcacgcagag
attcggaaccgatga

DBGET integrated database retrieval system