KEGG   Sus scrofa (pig): 396714Help
Entry
396714            CDS       T01009                                 

Gene name
AMELY
Definition
(RefSeq) amelogenin precursor
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Y
AA seq 189 aa AA seqDB search
MGTWIFFACLLGASLAMPLPPHPGHPGYINFSYEVLTPLKWYQNMIRHPYTSYGYEPMGG
WLHHQIIPVVSQQTPQSHALQPHHHIPMVPAQQPGIPQQPMMPLPGQHSMTPTQHHQPNL
PLPAQQPFQPQPVQPQPHQPLQPQSPMHPIQPLLPQPPLPPMFSMQSLLPDLPLEAWPAT
DKTKREEVD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggggacctggattttctttgcctgccttttgggagcatcccttgctatgcctctacca
cctcatcctgggcaccctggttatatcaacttcagctatgaggtgcttacccctctgaag
tggtaccagaacatgataagacatccgtacacttcctatgggtacgaacccatgggtgga
tggctgcaccaccaaatcatacccgtggtgtcgcagcagactccccagagtcatgccctt
cagcctcatcaccacatccccatggtgccagctcaacagcccgggatcccccagcagcca
atgatgccacttcctggccaacactccatgactccaacccaacaccaccagccaaacctc
cctctgcccgcccagcagcccttccagccccagcccgtccagccccagcctcaccagccc
ctgcagccccagtcacccatgcaccccatccagcccttgctgccacagccacctctgcct
ccgatgttctccatgcagtctctgcttcctgacctgcctctggaagcttggccagcaaca
gacaagaccaagcgggaggaagtggattaa

DBGET integrated database retrieval system