KEGG   Sus scrofa (pig): 396777Help
Entry
396777            CDS       T01009                                 

Gene name
USP18, ISG43, UBP
Definition
ubiquitin specific peptidase 18 (EC:3.1.2.-)
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     396777 (USP18)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   396777 (USP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 321 aa AA seqDB search
MGPVGLHNIGQTCCLNSLIQVLIMNVGLTKILKRMTVPRGAEEQRRNVPFQLLLLLEKMQ
DSRQKAVQPMELAYCLQKYNIPMFVQHDAAQLYLTVWNLIKDQITDVDLVARLQALYTIR
VKETFVCLECTTEHVRNSSMLTLPLSLFDMDSKPLKTLEDALHCFFQPRELSGRDKCFCE
NCGRKTCWKQVLKLSRLPQTLTLHLMRFSIKNLRTEKVCHSLYFPQSLDLNPLLETEEEP
CAAEGQPGGRYELFAVIAHMGLADFGHYCAYVWSAADGKWFCFNDSNVCWVSWEDIQCTY
GNHSFRWRETAYLLVYMMAES
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggcccggtcggtttgcacaacattggacagacctgctgccttaactccctgattcag
gtgctgattatgaatgtgggattaaccaagatactgaagaggatgacagtgccaagggga
gctgaggagcagaggagaaatgtccccttccagctgctcttgctgctggagaagatgcag
gacagccggcagaaggcggtgcaacccatggaacttgcctactgtctccagaagtacaat
ataccaatgtttgtccagcacgatgctgcccagctctacctcaccgtctggaacctgatc
aaggaccagatcacggatgtggacttggtggcgaggctgcaggccctctataccatccgc
gtgaaggagaccttcgtctgccttgaatgtaccacggagcatgtcaggaacagcagcatg
ctgaccctccccctttcgctgtttgacatggactcaaagcccctgaaaaccctggaggat
gccctgcactgcttcttccagcccagggagttgtccggcagagacaagtgcttctgtgag
aactgtggcaggaagacctgttggaagcaggtcctgaagctgagccgcctgccccagacc
ttgaccctgcacctcatgcggttctccatcaaaaatctgcggacagaaaaagtctgccac
tcactgtatttcccccagagcttggatctgaacccgctccttgagacggaggaagagccc
tgtgctgctgaggggcagcctgggggacggtacgagctcttcgctgtgatcgcccacatg
gggctggccgacttcggtcactactgcgcctacgtctggagcgccgcggatggaaaatgg
ttctgcttcaatgactccaatgtctgttgggtgtcctgggaagacatccagtgtacttat
ggaaatcacagcttccgctggcgggaaactgcatatcttctggtttacatgatggctgag
tcctga

DBGET integrated database retrieval system