KEGG   Sus scrofa (pig): 396864Help
Entry
396864            CDS       T01009                                 

Gene name
CYM
Definition
chymosin
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     396864 (CYM)
Peptidases [BR:ssc01002]
 Aspartic Peptidases
  Family A1: pepsin family
   396864 (CYM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 232 aa AA seqDB search
MVAGIVDAHQTVGLSTQEPSDIFTYSEFDGILGLGYPELASEYTVPVFDNMMHRHLVAQD
LFAVYMSRNDEGSMLTLGAIDPSYYTGSLHWVPVTMQLYWQFTVDSVTINGVVVACNGGC
QAILDTGTSMLAGPSSDILNIQMAIGATESQYGEFDIDCGSLSSMPTVVFEISGRMYPLP
PSAYTNQDQGFCTSGFQGDSKSQHWILGVVFIQEYYSVFDRANNRVGLAKAI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccggcatcgtggacgcccaccagaccgtgggcctgagcacccaggagcccagt
gacatcttcacctactcggagtttgacggcatcctggggctgggctaccccgagctcgcc
tctgagtacacggtgcctgtgtttgacaacatgatgcacaggcacctggtggcccaggac
ctgttcgcggtttacatgagcaggaatgacgaggggagcatgctcacgctgggggccatt
gacccgtcctactacacgggatccctgcactgggtgcccgtgaccatgcagttgtactgg
cagttcaccgtggacagtgtcaccatcaatggtgtggtggtggcctgtaatggtggctgt
caggccatcctggacacgggcacctccatgctggctgggcccagcagtgacatcctcaac
atccagatggccattggagccacagagagccagtatggcgagtttgacatcgactgcggc
agcctgagcagcatgcccaccgtggtctttgagatcagcggcagaatgtaccccctgccc
ccctccgcctacaccaaccaggaccagggcttctgcaccagtggcttccagggtgacagt
aagtctcagcactggatcctgggagttgtcttcatccaggagtattacagcgtctttgac
agagccaacaaccgcgtggggctggccaaggccatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system