KEGG   Sus scrofa (pig): 396979Help
Entry
396979            CDS       T01009                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc04022  cGMP-PKG signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04371  Apelin signaling pathway
ssc04611  Platelet activation
ssc04725  Cholinergic synapse
ssc04921  Oxytocin signaling pathway
ssc05145  Toxoplasmosis
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    396979 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    396979 (PIK3CG)
   04072 Phospholipase D signaling pathway
    396979 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    396979 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    396979 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    396979 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    396979 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396979 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    396979 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    396979 (PIK3CG)
   05145 Toxoplasmosis
    396979 (PIK3CG)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     396979 (PIK3CG)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    396979 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF3244
Motif
Other DBs
NCBI-GeneID: 396979
NCBI-ProteinID: NP_999104
Ensembl: ENSSSCG00000015437 ENSSSCG00000027272
UniProt: O02697
Structure
PDB: 

Jmol
Position
9
AA seq 1102 aa AA seqDB search
MELENYEQPVVLREDNRRRRRRMKPRSTAASLSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRALETSVSADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHVVQRHAPSEETLAFQRQLNALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCVFIVIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNERDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRTADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKTSAEMPSPESKGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDQGSFNADKLTSRTNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLAKREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNLNLP
QSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLSHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactatgaacagcccgtggtgctgagagaggacaaccgccgcaggcgt
cggaggatgaagccgcgcagcacggcagccagcctgtcctccatggagctcatccccatc
gagtttgttttgcccaccagccagcgcaacaccaagacccccgaaacggcactgctgcac
gtggccggccacggcaatgtggagcagatgaaggcccaggtgtggctgcgcgcgctggag
acgagcgtgtctgcggacttctaccaccggctcggccccgaccacttcctcctgctctac
cagaagaaggggcagtggtacgagatctatgacaagtaccaggtggtgcagaccctggac
tgcctgcgctactggaaggtgttgcaccgcagccccgggcagatccacgtggtccagcgg
cacgcgccctcggaggagacattggccttccagcgccagctcaacgccctcatcggctac
gacgtcaccgacgtcagcaacgtgcatgacgatgagctggagttcacgcggcgccgcctg
gtcaccccgcgcatggccgaggtggccggccgcgaccccaagctttacgccatgcacccc
tgggtgacatccaagcccctccctgagtaccttctgaagaagatcactaacaactgcgtc
ttcatcgtcattcaccgcagcaccaccagccagaccatcaaggtctcggccgatgacacc
ccaggcaccatcctccagagcttctttaccaagatggccaagaagaaatctctgatggat
atccctgaaagccagaacgaacgggactttgtgctgcgcgtctgcggccgggatgagtac
ctggtgggtgagacgcccatcaaaaatttccagtgggtgaggcagtgcctcaagaatggg
gaggagattcaccttgtgctggacactcctccagacccagccctggacgaggtgaggaag
gaagagtggccgctggtggatgactgcacgggagtcactggctaccacgagcagctgacc
atccacggcaaggaccatgaaagtgtgttcaccgtgtccctgtgggactgtgaccgcaag
ttcagggtcaaaatcagaggcattgatatccctgtcctgccccggaccgctgacctcacg
gtgtttgtggaggcaaacatccagtatgggcagcaagtcctttgccaaaggagaaccagc
cccaaacccttcacggaggaggtgctctggaacgtgtggcttgagttcagtattaaaatc
aaagacttacccaaaggggctctgctgaacctccagatctactgcggcaaagctccagca
ctgtctggcaagacctctgcagagatgcccagtcccgagtccaaaggcaaagctcagctt
ctgtactatgtcaacctattgctgatagaccaccgcttcctcctgcgccatggcgagtat
gtgctccacatgtggcagttatccgggaagggggaagaccaagggagcttcaatgccgac
aagctcacgtcgcgaaccaacccggacaaggagaactcaatgtctatctccattcttctg
gacaattactgccaccccatagccttgcctaagcatcggcctacccctgacccagaaggg
gaccgggttcgggcagaaatgcccaatcagcttcggaagcaactggaggcaatcatagcc
acggatccgcttaacccactcacagctgaagacaaagaactgctctggcatttcagatat
gaaagcctgaaggatcccaaagcgtatcctaagctctttagctcggtgaaatggggacag
caagaaattgtggccaaaacataccaattattagccaaaagggaggtctgggatcagagt
gctttggatgtggggttaaccatgcagctcctggactgcaacttctcggatgaaaacgtg
agagccattgcagtccagaaactggagagcttggaggatgatgacgtgctccattacctg
ctccagctggtccaggctgtgaaatttgaaccataccatgacagtgccctagccagattt
ctgctgaagcgtggtttaagaaacaagagaattggtcacttcttgttttggttcttgaga
agtgagattgcccagtctaggcactatcagcagaggtttgcagtgatcctggaagcctac
ctgaggggctgtggcacagccatgctgcacgacttcacccagcaagtccaagtaattgac
atgttacaaaaagtcaccattgacattaaatcgctctctgctgaaaagtatgacgtcagt
tcccaagttatttcccaacttaagcaaaagcttgaaaacctacagaatttgaatctcccc
caaagctttagagttccctatgatcctggactgaaagccggggcactggtgatcgaaaaa
tgtaaagtgatggcctccaagaagaagcccctgtggcttgagtttaaatgtgccgatcct
acggctctatcaaatgaaacaattggaattatctttaaacacggtgacgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtccatttgggagaccgaatctttg
gatctgtgcctcctgccatatggctgcatttcaactggtgacaaaataggaatgatcgag
atcgtgaaggacgccacgacaatcgccaaaattcagcaaagcacagtgggcaacacgggt
gcctttaaagatgaagtcctgagtcactggctcaaagaaaaatgccctattgaagaaaag
tttcaggcagctgtggagagatttgtttattcctgtgccggctactgtgtggcaaccttt
gttctcggaataggcgacagacacaatgacaatattatgatctcagaaacaggaaatcta
tttcatattgatttcggacacattcttgggaattacaaaagtttcctgggcattaataaa
gagagggtgccatttgtgctaaccccagacttcctgtttgtgatggggacttctggaaag
aagacaagtctacacttccagaaatttcaggatgtctgcgtcaaggcttacctagccctt
cgtcatcacacaaacctactgatcatcctcttctccatgatgctgatgacaggaatgccc
cagttaaccagcaaagaagacattgaatacattcgggatgccctcacagtgggcaaaagt
gaggaggatgctaaaaagtattttctggatcagattgaagtttgcagagacaaaggatgg
accgtgcagtttaactggttcttacatcttgttcttggcatcaaacaaggggagaagcat
tccgcataa

DBGET integrated database retrieval system