KEGG   Sus scrofa (pig): 397012Help
Entry
397012            CDS       T01009                                 

Gene name
HADHA
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit (EC:4.2.1.17 1.1.1.211)
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
ssc  Sus scrofa (pig)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    397012 (HADHA)
   01212 Fatty acid metabolism
    397012 (HADHA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    397012 (HADHA)
   00650 Butanoate metabolism
    397012 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    397012 (HADHA)
   00071 Fatty acid degradation
    397012 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    397012 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    397012 (HADHA)
   00310 Lysine degradation
    397012 (HADHA)
   00380 Tryptophan metabolism
    397012 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    397012 (HADHA)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     397012 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     397012 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 763 aa AA seqDB search
MVASRAIGSLRRFTASQTLRCPGYICRNFTRSSALLTRTHINYGVKGDVAVIRINSPNSK
VNTLGQELHSEFIEVMNEVWSSSQIRSAVLISSKPGCFIAGADINMLSACTTSQEVTQIS
QEAQRTFEKLEKSTKPIVAAINGTCLGGGLELAISCQYRIATKDKKTVLGAPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRGIRADKAKKMGLVDQLVEPLGPGLKPPEERTIEYL
EEVAVTFAKGLADKKISPKRDKGLVEKLTSYAMSIPFVRQQIYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSDAGYLSESQKFGELAMTKESKALMGLYRGQTLCKKNKFGAPQKE
VKHLAILGAGLMGAGIAQVSVDKHLKTILKDASLPALGRGQQQVFKGLNDKVRKKALTSF
ERDSLFSNLTGQLDYQGFEKADMVIEAVFEELSLKHKVLKEVEAVIPDHCVFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDSTASAVEVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVLRILQEGVGPKKLDSLTTSFGFPVGAATLMDEVGMDVAKHVA
ENLGKIFGERFAGGNLDVLKQMISKGFLGRKSGKGFYVYQEGVKNRNVNSDTESILASLK
IPSRPDISSDEDIQYRLVTRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKVVDRLRKYEAIYGKQFTPCQLLIDHASSPNKKFFQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcctcccgggcaataggcagcctccgtcgcttcactgcctcccagacgctccgc
tgcccagggtacatttgccgcaactttacaaggtcttctgctttgctgaccagaacccat
attaactatggagtcaaaggggatgtggcagttatccgaattaactcacccaattcaaag
gtaaatactctgggtcaggaactgcattcagagttcatagaagtgatgaatgaagtctgg
tctagcagtcagatcagaagcgctgtccttatctcatcaaagccaggctgcttcattgca
ggtgctgatatcaacatgttatcagcttgcacgacctctcaagaggtaacgcaaatatca
caggaagcacagagaacatttgagaaacttgagaagtccacaaagcctattgtggctgcc
atcaatggaacctgcttaggaggaggacttgagcttgccatttcgtgccagtacagaata
gcaacaaaagataagaaaacagtattaggggcccctgaagtcttgctgggaatcttacca
ggagcaggaggcacacaaaggctacccaaaatggtgggtgtgcctgctgcttttgacatg
atgctgactggtagaggcattcgggcagacaaagcaaagaaaatggggctggttgaccaa
ctggtggaaccgctgggaccaggattaaaacctccagaggaacggacaattgaataccta
gaagaagttgcagttacttttgccaaaggactagctgataaaaagatctctccaaagaga
gacaagggactggtggaaaaactgacatcgtacgccatgagtattccatttgtcagacaa
cagatttacaaaaaggtggaagaaaaagtacgaaagcagaccaaaggcctttatcctgcg
cctctgaaaattatcgatgtagtaaagactgggatcgagcaagggagtgacgccggctat
ctctctgaatctcagaaatttggagagcttgcaatgaccaaagaatcaaaagccttgatg
ggactttaccgtggtcagaccctatgcaagaagaataaatttggagctccgcagaaggag
gttaagcaccttgccattcttggcgcagggctgatgggagccggcattgcccaggtctcc
gtggataagcacctaaagactatacttaaggatgcttcactgccggcgctgggccgagga
cagcaacaagtgttcaaaggactgaatgataaagtgaggaagaaagcactaacatcattt
gaaagggactcccttttcagcaacttgaccgggcagctcgattaccagggttttgaaaag
gccgacatggtgattgaagctgttttcgaagagctgagtcttaagcacaaagtgctcaaa
gaggtagaggcggtgattccagatcactgtgtctttgccagcaacacgtctgctctcccg
atcagtgaaattgctgctgtcagtaaaagacctgagaaggtgattggcatgcactacttc
tctcctgtggacaagatgcagctgctggagattatcaccactgaaaaaacctctaaggac
tcaactgcttcggccgtagaagttggtctcaaacaggggaaggtcatcattgtggttaag
gatggacccggcttctacaccaccaggtgccttgcacccatgatgtctgaagtcctcaga
attctccaggaaggagttggccctaagaagctggactccctgaccacgagctttggcttt
cctgtgggcgctgcgacgctgatggatgaagttggcatggatgtagcgaaacacgtagcg
gaaaatctaggcaaaatctttggggagcggtttgcaggtggaaacctggacgtgctgaag
cagatgatatccaagggcttcctgggtcgcaagtctgggaagggcttttacgtctaccag
gagggagtgaagaatcggaatgtgaattctgacacggagagcattttggcaagtctgaag
ataccctctcggcctgacatctcttcagacgaagacatccagtaccgcctggtgaccaga
ttcgtgaacgaggctgtcctgtgcctgcaggaagggatcttggccacgcctgccgagggc
gacatcggggccgtctttgggctcggcttccccccctgtcttggagggcccttccggttt
gtggatctgtacggggctcagaaggtcgtggaccggctccggaagtacgaggccatctat
gggaaacagttcacgccatgccagctgctgattgaccatgccagcagcccaaataagaag
ttcttccagtga

DBGET integrated database retrieval system