KEGG   Sus scrofa (pig): 397012Help
Entry
397012            CDS       T01009                                 

Gene name
HADHA
Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00062  Fatty acid elongation
ssc00071  Fatty acid degradation
ssc00280  Valine, leucine and isoleucine degradation
ssc00310  Lysine degradation
ssc00380  Tryptophan metabolism
ssc00410  beta-Alanine metabolism
ssc00640  Propanoate metabolism
ssc00650  Butanoate metabolism
ssc01040  Biosynthesis of unsaturated fatty acids
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc01212  Fatty acid metabolism
Module
ssc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
ssc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ssc_M00085  Fatty acid biosynthesis, elongation, mitochondria
ssc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    397012 (HADHA)
   00650 Butanoate metabolism
    397012 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    397012 (HADHA)
   00071 Fatty acid degradation
    397012 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    397012 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    397012 (HADHA)
   00310 Lysine degradation
    397012 (HADHA)
   00380 Tryptophan metabolism
    397012 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    397012 (HADHA)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     397012 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     397012 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 397012
NCBI-ProteinID: NP_999127
Ensembl: ENSSSCG00000008571
UniProt: Q29554
Position
3
AA seq 763 aa AA seqDB search
MVASRAIGSLRRFTASQTLRCPGYICRNFTRSSALLTRTHINYGVKGDVAVIRINSPNSK
VNTLGQELHSEFIEVMNEVWSSSQIRSAVLISSKPGCFIAGADINMLSACTTSQEVTQIS
QEAQRTFEKLEKSTKPIVAAINGTCLGGGLELAISCQYRIATKDKKTVLGAPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRGIRADKAKKMGLVDQLVEPLGPGLKPPEERTIEYL
EEVAVTFAKGLADKKISPKRDKGLVEKLTSYAMSIPFVRQQIYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSDAGYLSESQKFGELAMTKESKALMGLYRGQTLCKKNKFGAPQKE
VKHLAILGAGLMGAGIAQVSVDKHLKTILKDASLPALGRGQQQVFKGLNDKVRKKALTSF
ERDSLFSNLTGQLDYQGFEKADMVIEAVFEELSLKHKVLKEVEAVIPDHCVFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDSTASAVEVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVLRILQEGVGPKKLDSLTTSFGFPVGAATLMDEVGMDVAKHVA
ENLGKIFGERFAGGNLDVLKQMISKGFLGRKSGKGFYVYQEGVKNRNVNSDTESILASLK
IPSRPDISSDEDIQYRLVTRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKVVDRLRKYEAIYGKQFTPCQLLIDHASSPNKKFFQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcctcccgggcaataggcagcctccgtcgcttcactgcctcccagacgctccgc
tgcccagggtacatttgccgcaactttacaaggtcttctgctttgctgaccagaacccat
attaactatggagtcaaaggggatgtggcagttatccgaattaactcacccaattcaaag
gtaaatactctgggtcaggaactgcattcagagttcatagaagtgatgaatgaagtctgg
tctagcagtcagatcagaagcgctgtccttatctcatcaaagccaggctgcttcattgca
ggtgctgatatcaacatgttatcagcttgcacgacctctcaagaggtaacgcaaatatca
caggaagcacagagaacatttgagaaacttgagaagtccacaaagcctattgtggctgcc
atcaatggaacctgcttaggaggaggacttgagcttgccatttcgtgccagtacagaata
gcaacaaaagataagaaaacagtattaggggcccctgaagtcttgctgggaatcttacca
ggagcaggaggcacacaaaggctacccaaaatggtgggtgtgcctgctgcttttgacatg
atgctgactggtagaggcattcgggcagacaaagcaaagaaaatggggctggttgaccaa
ctggtggaaccgctgggaccaggattaaaacctccagaggaacggacaattgaataccta
gaagaagttgcagttacttttgccaaaggactagctgataaaaagatctctccaaagaga
gacaagggactggtggaaaaactgacatcgtacgccatgagtattccatttgtcagacaa
cagatttacaaaaaggtggaagaaaaagtacgaaagcagaccaaaggcctttatcctgcg
cctctgaaaattatcgatgtagtaaagactgggatcgagcaagggagtgacgccggctat
ctctctgaatctcagaaatttggagagcttgcaatgaccaaagaatcaaaagccttgatg
ggactttaccgtggtcagaccctatgcaagaagaataaatttggagctccgcagaaggag
gttaagcaccttgccattcttggcgcagggctgatgggagccggcattgcccaggtctcc
gtggataagcacctaaagactatacttaaggatgcttcactgccggcgctgggccgagga
cagcaacaagtgttcaaaggactgaatgataaagtgaggaagaaagcactaacatcattt
gaaagggactcccttttcagcaacttgaccgggcagctcgattaccagggttttgaaaag
gccgacatggtgattgaagctgttttcgaagagctgagtcttaagcacaaagtgctcaaa
gaggtagaggcggtgattccagatcactgtgtctttgccagcaacacgtctgctctcccg
atcagtgaaattgctgctgtcagtaaaagacctgagaaggtgattggcatgcactacttc
tctcctgtggacaagatgcagctgctggagattatcaccactgaaaaaacctctaaggac
tcaactgcttcggccgtagaagttggtctcaaacaggggaaggtcatcattgtggttaag
gatggacccggcttctacaccaccaggtgccttgcacccatgatgtctgaagtcctcaga
attctccaggaaggagttggccctaagaagctggactccctgaccacgagctttggcttt
cctgtgggcgctgcgacgctgatggatgaagttggcatggatgtagcgaaacacgtagcg
gaaaatctaggcaaaatctttggggagcggtttgcaggtggaaacctggacgtgctgaag
cagatgatatccaagggcttcctgggtcgcaagtctgggaagggcttttacgtctaccag
gagggagtgaagaatcggaatgtgaattctgacacggagagcattttggcaagtctgaag
ataccctctcggcctgacatctcttcagacgaagacatccagtaccgcctggtgaccaga
ttcgtgaacgaggctgtcctgtgcctgcaggaagggatcttggccacgcctgccgagggc
gacatcggggccgtctttgggctcggcttccccccctgtcttggagggcccttccggttt
gtggatctgtacggggctcagaaggtcgtggaccggctccggaagtacgaggccatctat
gggaaacagttcacgccatgccagctgctgattgaccatgccagcagcccaaataagaag
ttcttccagtga

DBGET integrated database retrieval system