KEGG   Sus scrofa (pig): 397027Help
Entry
397027            CDS       T01009                                 

Gene name
CAPN1
Definition
(RefSeq) calpain 1, (mu/I) large subunit (EC:3.4.22.52)
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
ssc  Sus scrofa (pig)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    397027 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    397027 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    397027 (CAPN1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     397027 (CAPN1)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C2: calpain family
   397027 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 650 aa AA seqDB search
MAEEVITPVYCTGVSAQVQKLRAKELGLGRHENAIKYLGQDYEQLRAHCLQSGSLFRDEA
FPPVPQSLGFKELGPNSSKTYGVKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYSIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYQRDQLRVRMEDGEFWMSFRDFLREFTRLEICNLTPDALKS
QRVRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPEDDYGGRESGCSF
VLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKKAGTQELDDQVQAILPDEQVLSE
EEIDENFKALFRQLAGEDMEISVRELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGEA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaggtcatcactccggtgtactgcactggggtgtctgcacaagtgcagaag
ctgcgggccaaggagctgggcctgggccgccatgaaaatgccatcaagtacctgggccag
gattacgagcagctccgggctcactgcctgcagagtgggagcctcttccgtgatgaggct
ttccctccagtgccgcagagcctgggcttcaaggaactgggccccaactcctccaaaacc
tatggcgtcaagtggaagcgtcccacggagctgttctcaaacccccagttcatcgtggat
ggagccacccgcacagacatctgccagggagcactgggggactgctggctcctggctgcc
atcgcctcccttaccctcaacgacaccctcctgcaccgagtagttccacacggccaaagc
ttccagaatggctatgctggcatcttccatttccagctgtggcagtttggggagtgggtg
gacgtggtggtggatgacctgctgcccaccaaagacgggaagctggtgttcgtgcactct
gcccaaggcaatgagttctggagcgccctgctcgagaaggcttatgccaaggtgaatggc
agctacgaggccctgtccgggggcagcacctccgagggctttgaggacttcacgggcggg
gtcaccgagtggtacgagctgcggaaggcacccagcgacctctacagcatcatcctcaag
gcgctggagcgaggctccctgctgggctgctccattgacatctccagcgttctggacatg
gaggctgtcaccttcaagaagctagtgaagggccacgcctactccgtgactggggccaag
caggtgaactaccagggccagatggtgaacctgatccggatgcggaacccctggggcgag
gtggagtggacgggagcctggagtgatggctcctcggagtggaacggcgtggacccctac
cagcgggatcagctccgggtccggatggaggatggggagttctggatgtccttccgagac
ttcttgcgtgagttcacccgcctggagatctgcaacctgacgcccgacgcgctcaagagc
cagagggtccgcaactggaacaccaccctctacgagggcacctggcggcgggggagcacc
gcggggggctgccgcaactacccagccaccttctgggtgaacccccagttcaagatccgg
ctggaggagacggatgacccagaggacgactacgggggccgtgagtcgggctgcagcttc
gtgctcgccctcatgcagaaacaccgccgccgggagcgccgattcggacgcgacatggag
accatcggctttgccgtctatgaggtccctccggagctggtgggccagccggtgcacctg
aagcgggacttcttcctggccaacgcctctcgggcccggtccgagcagttcatcaacctg
cgggaggtcagtacccgcttccgcctgccgcccggcgagtacgtggtggtgccttccacc
ttcgagcccaacaaggagggcgactttgtgctgcgtttcttctcagagaagaaagccggg
acccaagagctggacgaccaggtccaggccattctccccgacgagcaagtgctctcggaa
gaggagattgatgagaacttcaaagcgctcttcagacagctggcaggggaggacatggag
atcagcgtcagggagctgcgcaccatcctcaacaggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctggagtcctgccgcagcatggtcaacctcatggaccgtgat
ggcaacgggaagctgggcctggtggaattcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagttcgacttggacaagtcaggcagcatgagcgcctacgagatg
cggatggccatcgagtctgcaggtgaggcctga

DBGET integrated database retrieval system