KEGG   Sus scrofa (pig): 397048Help
Entry
397048            CDS       T01009                                 

Gene name
ST5AR2, S5AR_2, Srd5a2
Definition
steroid 5-alpha-reductase 2 (EC:1.3.1.22)
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    397048 (ST5AR2)
 Human Diseases
  Cancers
   05215 Prostate cancer
    397048 (ST5AR2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     397048 (ST5AR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 254 aa AA seqDB search
MPVRCQQSPVLAGSATLAALGALALYFAEPSGYGKYTESLTPAAIRLPARAAWFLQELPS
FVVPAGILAGQPRSLFGPPATVLLGLFCAHYFHRTFVYSLLTRGRPFPVVFLFRGFVFCM
GNGLLQGYYLVYCAEYPAEWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEVIYKI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYVKMFE
DYPKSRKALIPFIF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttcgctgccagcagagcccggtgctggcgggcagcgccactttggctgccctg
ggggcactggccctgtacttcgcggagccctctggctacgggaagtacacggagagcctg
acgcccgcggctatccgcctgccagcccgtgccgcctggttcctgcaggagctgccctcc
ttcgtggtgcccgcggggatcctcgccgggcagccccgttctctcttcggcccgcctgcg
actgtgcttctgggcctcttctgcgcacattacttccacaggacatttgtttactcactg
ctcactagagggaggccttttccagttgtattccttttcagaggctttgtcttctgcatg
ggaaatggactccttcaaggctactatctggtttactgtgccgaataccctgctgagtgg
tacacagacatacggtttagcctaggtgtgttcttatttattttgggcatgggaatcaac
attcacagcgactatatattgcgccagctcaggaagcctggagaagtcatctataagatt
ccacaaggtggcttgttcacgtacgtttctggagccaatttccttggtgagatcattgaa
tggatcggctatgccttggccacttggtcccttccagcacttgcatttgcatttttctcg
ctttgtttccttgggctgcgagcttttcaccatcataggttctacgtcaagatgtttgag
gactaccccaagtctcgaaaagcccttattccatttatcttttaa

DBGET integrated database retrieval system