KEGG   Sus scrofa (pig): 397054Help
Entry
397054            CDS       T01009                                 

Gene name
DLAT
Definition
dihydrolipoamide S-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ssc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ssc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ssc00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 647 aa AA seqDB search
MWRVCAPRAQNAAPRAGFGARWTALREEPGAPCAAPRAGSVPARCSSTTRGYGRSRALCG
WSATRGATPQNRILLQLWGSPNRRWYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGELIAEVETDKATVGFESLEECYMAKILVAEGTRDVPVGAIICITVEKPEDIEAFKNYT
LDSSAAPAPQAAPAPTPAAAAPAPTPSAQAPGSSYPTHMQVVLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEGTRDVPLGTPLCIIVEKEADI
PAFADYRPTEVTDLKPPAPPPTPSPVTPVPPAPQPVAPTPAATRPATPAGPKGRLFVSPL
AKKLASEKGIDLTQIKGTGPDGRIIKKDIDSFVPTKAAPTPAAAVPPPSPGVAPVPTGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGRSKISVNDFI
IKASALACLKVPEANSSWLDTVIRQNHVVDISVAVSTPAGLITPIVFNAHIKGLETIAND
VVSLATKAREGKLQPHEVQGGTFTISNLGMFGIKNFSAIINPPQACILAVGASEDRLFPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtgtgtgcgccacgggcccagaatgcagccccaagggcaggattcggggca
cggtggacggctttgcgggaggagccaggagctccgtgcgcggcccctcgggctggctct
gttccggctcgttgcagcagcacgactagagggtatggcaggagccgggcactctgcggc
tggagcgccactcgtggggccacacctcagaatcgtatcctactgcagctttgggggtct
cctaaccgccgctggtatagcctccccccgcatcagaaggttccattgccttctctttcc
cccacaatgcaggcagggaccatagcccgttgggaaaaaaaggaaggggacaaaatcaat
gagggtgaactaattgcagaggttgaaactgataaagctactgttggatttgagagcctg
gaggagtgttacatggcaaagatacttgttgctgagggtaccagagatgttccagttgga
gcaatcatttgtataactgttgaaaagcctgaagacattgaggcctttaaaaattataca
ttggattcttcggcggcacctgccccacaagcagccccagctccgactcctgcagctgct
gctccagcacccacaccttctgctcaggctcctggtagctcatatcccactcacatgcag
gtggttcttcctgccctctctcccaccatgaccatgggcacagttcagagatgggaaaaa
aaagtgggtgagaagctaagtgaaggagacttattggcagagatagagactgacaaggcc
actataggttttgaggtacaggaagaaggttacctggcaaaaatcctgatccctgaaggc
acaagagatgtcccgctaggaaccccactttgtatcattgtagaaaaagaggcagatata
ccagcatttgctgactatcggccaactgaagtaactgatttaaaaccaccagcaccacca
cctaccccgtccccggtgacccctgttcctccagctccccaacctgtagcccctacacct
gcagccacccgcccagctactcctgctggaccaaagggaaggttgtttgttagccctctt
gcaaagaaattggcatcagagaaaggcattgaccttacacaaataaaagggacaggacca
gatggcagaatcatcaagaaggacattgactcctttgtgcctactaaagctgctcctact
ccagcagctgctgttcctcccccgagcccaggagtggcaccagttcccacaggggtcttc
acagatatcccaatcagcaacattcgtcgagttattgcacagcggttaatgcaatctaag
caaaccatacctcattattacctttctgttgatgtaaatatgggagaagttttgttggta
cggaaagaacttaataagatgttagaagggagaagcaaaatttctgtcaatgatttcatt
ataaaagcttcagccttggcatgtttaaaagttcctgaagcaaattcttcttggctggac
acagttataagacaaaatcatgttgttgatatcagtgtcgcagtcagcactcctgcagga
ctcatcacacctattgtatttaatgcacatataaaaggactggaaaccattgctaatgat
gttgtttctttagcaaccaaagcacgagagggtaaactacagccacatgaggtccagggt
ggcacttttacaatctcgaatttaggaatgtttggaattaagaacttctctgctattatt
aaccctcctcaagcatgtattttggcagttggtgcttcagaggatagactgtttccagcg
gataatgaaaaaggatttgacgtagctagcatgatgtctgttacactcagctgtgatcat
cgggttgtggatggagcagttggagcccagtggcttgctgagtttagaaagtaccttgaa
aaaccaatcaccatgttgttataa

DBGET integrated database retrieval system