KEGG   Sus scrofa (pig): 397086Help
Entry
397086            CDS       T01009                                 

Gene name
TNF, TNFa
Definition
tumor necrosis factor
Orthology
K03156  
tumor necrosis factor superfamily, member 2
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
mTOR signaling pathway
Apoptosis
TGF-beta signaling pathway
Osteoclast differentiation
Antigen processing and presentation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Hematopoietic cell lineage
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Proteoglycans in cancer
Asthma
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    397086 (TNF)
   04350 TGF-beta signaling pathway
    397086 (TNF)
   04064 NF-kappa B signaling pathway
    397086 (TNF)
   04668 TNF signaling pathway
    397086 (TNF)
   04150 mTOR signaling pathway
    397086 (TNF)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397086 (TNF)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    397086 (TNF)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    397086 (TNF)
   04620 Toll-like receptor signaling pathway
    397086 (TNF)
   04621 NOD-like receptor signaling pathway
    397086 (TNF)
   04622 RIG-I-like receptor signaling pathway
    397086 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    397086 (TNF)
   04612 Antigen processing and presentation
    397086 (TNF)
   04660 T cell receptor signaling pathway
    397086 (TNF)
   04664 Fc epsilon RI signaling pathway
    397086 (TNF)
  Endocrine system
   04920 Adipocytokine signaling pathway
    397086 (TNF)
  Development
   04380 Osteoclast differentiation
    397086 (TNF)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    397086 (TNF)
  Immune diseases
   05310 Asthma
    397086 (TNF)
   05322 Systemic lupus erythematosus
    397086 (TNF)
   05323 Rheumatoid arthritis
    397086 (TNF)
   05321 Inflammatiory bowel disease (IBD)
    397086 (TNF)
   05330 Allograft rejection
    397086 (TNF)
   05332 Graft-versus-host disease
    397086 (TNF)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    397086 (TNF)
   05014 Amyotrophic lateral sclerosis (ALS)
    397086 (TNF)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    397086 (TNF)
   05414 Dilated cardiomyopathy (DCM)
    397086 (TNF)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    397086 (TNF)
   04930 Type II diabetes mellitus
    397086 (TNF)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    397086 (TNF)
  Infectious diseases
   05133 Pertussis
    397086 (TNF)
   05134 Legionellosis
    397086 (TNF)
   05152 Tuberculosis
    397086 (TNF)
   05166 HTLV-I infection
    397086 (TNF)
   05164 Influenza A
    397086 (TNF)
   05161 Hepatitis B
    397086 (TNF)
   05160 Hepatitis C
    397086 (TNF)
   05168 Herpes simplex infection
    397086 (TNF)
   05146 Amoebiasis
    397086 (TNF)
   05144 Malaria
    397086 (TNF)
   05145 Toxoplasmosis
    397086 (TNF)
   05140 Leishmaniasis
    397086 (TNF)
   05142 Chagas disease (American trypanosomiasis)
    397086 (TNF)
   05143 African trypanosomiasis
    397086 (TNF)
Heparan sulfate/heparin binding proteins [BR:ssc00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  397086 (TNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
7p11-q11; 7
AA seq 232 aa AA seqDB search
MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQK
EEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKD
NQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRET
PEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgagagcatgatccgagacgtggagctggcggaggaggcgctcgccaagaag
gccgggggcccccagggctccaggaggtgcctgtgcctcagcctcttctccttcctcctg
gtcgcaggagccaccacgctcttctgcctactgcacttcgaggttatcggcccccagaag
gaagagtttccagctggccccttgagcatcaaccctctggcccaaggactcagatcatcg
tctcaaacctcagataagcccgtcgcccacgttgtagccaatgtcaaagccgagggacag
ctccaatggcagagtgggtatgccaatgccctcctggccaacggcgtgaagctgaaagac
aaccagctggtggtgccgacagatgggctgtacctcatctactcccaggtcctcttcagg
ggccaaggctgcccttccaccaacgttttcctcactcacaccatcagccgcatcgccgtc
tcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggagacc
cccgagggggccgaggccaagccctggtacgaacccatctacctgggaggggtcttccag
ctggagaaggatgatcgactcagtgccgagatcaacctgcccgactatctggactttgct
gaatctgggcaggtctattttgggatcattgccctgtga

DBGET integrated database retrieval system