KEGG   Sus scrofa (pig): 397086Help
Entry
397086            CDS       T01009                                 

Gene name
TNF, TNFa
Definition
tumor necrosis factor
Orthology
K03156  
tumor necrosis factor superfamily, member 2
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
mTOR signaling pathway
Apoptosis
TGF-beta signaling pathway
Osteoclast differentiation
Antigen processing and presentation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Hematopoietic cell lineage
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Proteoglycans in cancer
Asthma
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ssc04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:ssc04350]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:ssc04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:ssc04668]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:ssc04150]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:ssc04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:ssc04210]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:ssc04640]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:ssc04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:ssc04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:ssc04622]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:ssc04650]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:ssc04612]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:ssc04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:ssc04664]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:ssc04920]
Organismal Systems; Development; Osteoclast differentiation [PATH:ssc04380]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:ssc05205]
Human Diseases; Immune diseases; Asthma [PATH:ssc05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ssc05322]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:ssc05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:ssc05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:ssc05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:ssc05332]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:ssc05010]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:ssc05014]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:ssc05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:ssc05414]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:ssc04940]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:ssc04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:ssc04932]
Human Diseases; Infectious diseases; Pertussis [PATH:ssc05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:ssc05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ssc05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ssc05166]
Human Diseases; Infectious diseases; Influenza A [PATH:ssc05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:ssc05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:ssc05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:ssc05168]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ssc05146]
Human Diseases; Infectious diseases; Malaria [PATH:ssc05144]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ssc05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:ssc05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:ssc05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:ssc05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
7p11-q11; 7
AA seq 232 aa AA seqDB search
MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQK
EEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKD
NQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRET
PEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgagagcatgatccgagacgtggagctggcggaggaggcgctcgccaagaag
gccgggggcccccagggctccaggaggtgcctgtgcctcagcctcttctccttcctcctg
gtcgcaggagccaccacgctcttctgcctactgcacttcgaggttatcggcccccagaag
gaagagtttccagctggccccttgagcatcaaccctctggcccaaggactcagatcatcg
tctcaaacctcagataagcccgtcgcccacgttgtagccaatgtcaaagccgagggacag
ctccaatggcagagtgggtatgccaatgccctcctggccaacggcgtgaagctgaaagac
aaccagctggtggtgccgacagatgggctgtacctcatctactcccaggtcctcttcagg
ggccaaggctgcccttccaccaacgttttcctcactcacaccatcagccgcatcgccgtc
tcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggagacc
cccgagggggccgaggccaagccctggtacgaacccatctacctgggaggggtcttccag
ctggagaaggatgatcgactcagtgccgagatcaacctgcccgactatctggactttgct
gaatctgggcaggtctattttgggatcattgccctgtga

DBGET integrated database retrieval system