KEGG   Sus scrofa (pig): 397098Help
Entry
397098            CDS       T01009                                 

Gene name
ACR
Definition
acrosin (EC:3.4.21.10)
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     397098 (ACR)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   397098 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p15
AA seq 400 aa AA seqDB search
MLPTAVLVLAVSVAARDNATCDGPCGLRFRQKLESGMRVVGGMSAEPGAWPWMVSLQIFM
YHNNRRYHTCGGILLNSHWVLTAAHCFKNKKKVTDWRLIFGANEVVWGSNKPVKPPLQER
FVEEIIIHEKYVSGLEINDIALIKITPPVPCGPFIGPGCLPQFKAGPPRAPQTCWVTGWG
YLKEKGPRTSPTLQEARVALIDLELCNSTQWYNGRVTSTNVCAGYPRGKIDTCQGDSGGP
LMCRDRAENTFVVVGITSWGVGCARAKRPGVYTSTWPYLNWIASKIGSNALQMVQLGTPP
RPSTPAPPVRPPSVQTPVRPPWYFQRPPGPSQQPGSRPRPPAPPPAPPPPPPPPPPPPPP
PPPPPQQVSAKPPQALSFAKRLQQLIELKGTAFSSGKELL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaactgccgttctggtcctggcagtgtctgtggcggccagagataacgccacg
tgtgatggcccctgcggcttacggttcaggcagaaattagagtcaggcatgcgtgtggtt
ggcggcatgagtgcagaaccgggcgcctggccctggatggtcagcctccagatctttatg
taccacaacaaccggaggtaccacacgtgcgggggcatcttgctgaactcgcactgggtg
ctcactgctgctcactgcttcaagaacaaaaaaaaagttactgactggagactgattttc
ggagcaaacgaagttgtgtggggaagcaataagccggtgaagccacccctgcaggagaga
tttgttgaggagatcatcattcatgaaaaatacgtttcagggttagagataaatgacatt
gctctcataaagatcacccctcctgttccatgcgggcccttcatcggaccaggctgcctg
ccccagtttaaggctggcccgcccagagcgccccagacatgctgggtgactggctggggc
tacttaaaagagaaaggccccaggacgtcacctacactgcaggaggcacgtgtggccctc
atcgacctcgaattatgtaactcgacccagtggtacaatgggcgtgtcacgtcaactaat
gtgtgcgcagggtatcctagaggcaagattgacacctgccagggggacagcggcgggcct
ctcatgtgcagagacagagcggaaaacacctttgtggtcgtgggcatcacaagctggggg
gtaggctgcgcccgagctaagcgccctggagtctacacgtctacctggccctatctgaac
tggattgcttccaagattggttctaatgccttgcagatggttcaactgggcacccctccc
cgtccttctactccagcaccccctgtcagacccccctctgttcagactcctgttcgccca
ccttggtacttccaacgccctcctggaccctcccagcaacctgggtcccgcccccgcccc
ccagctcccccccctgccccgccccccccgccccccccacccccaccgcctccaccaccc
ccacccccacccccacagcaagtttccgctaaacctccccaagcactttcctttgccaag
cgactgcagcagctcatagagctgaaggggacggcattctctagtggaaaggagctatta
tga

DBGET integrated database retrieval system