KEGG   Sus scrofa (pig): 397103Help
Entry
397103            CDS       T01009                                 

Gene name
PCSK1, PC1/3
Definition
proprotein convertase subtilisin/kexin type 1 (EC:3.4.21.93)
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     397103 (PCSK1)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S8: subtilisin family
   397103 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2q; 2
AA seq 753 aa AA seqDB search
MERRAWTLQCTAFTLFCAWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVIWAEQQYEKERSKRSLLRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHDDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWSSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEPQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTGTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKVVDSEEEQPTQENLNESPLVSKSPSGSSVGGRREELAE
GAPSEAMLRLLQSAFSKNSAPKQSPKKSASVKLNIPYENFYEALEKLNQPSQLKDSEDSL
YNDYVDVFYNTKPYKHRDDRLLQALVDILREEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggactctgcagtgtactgctttcactctcttttgcgcttggtgt
gcattaaacagtgtaaaagcgaagaggcagtttgtgaatgaatgggcagcggagatcccc
gggggaccagaggcagcctcggccatagcggaggagctaggctatgaccttttgggtcag
ataggatcacttgaaaatcactacttattcaaacataaaagccatcctcgaagatctcga
aggagtgcccttcatatcactaagagattatctgatgatgaccgtgtgatatgggctgaa
caacagtatgaaaaagagagaagtaaacgttcacttctaagagactcagcactaaatctc
tttaatgatccgatgtggaatcagcaatggtacttgcaagatactaggatgactgcagcc
ctgcccaagctggacctccatgtgatacctgtttggcaaaaaggcataacaggcaaagga
gttgttattactgtactggatgatggcttggagtggaatcacacagacatctatgccaac
tatgatccagaggctagctatgattttaacgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgctatgcaagca
aataatcacaagtgtggggtcggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgactgatgctatagaagccagctcaattggatttaatcctggacat
gtggatatttacagtgcaagctggggccctaatgatgatgggaaaactgtggaagggcct
ggccgactagcccagaaggcttttgaatatggtgtcaaacaggggagacaaggaaagggc
tctatcttcgtctgggcttctggaaatgggggacgtcagggagataactgtgactgtgat
gggtacacagacagcatctacaccatctccatcagcagtgcctcgcagcaaggcctatcc
ccctggtatgctgagaagtgctcctccacactggccacctcgtacagcagtggggattac
accgaccagcgaatcacgagtgctgacctgcacgatgactgcacagagacccacacaggc
acctcggcctctgcacccctggctgctggcatcttcgctctggccctggaagcaaatcca
aatctcacctggcgagatatgcaacacctggttgtctggacctctgagtatgacccactg
gcaaataatcctggatggaaaaagaatggagcaggcttgatggtgaacagtcggtttgga
tttgggttgctaaatgccaaagctctggtggatctagctgatcccaggacctggagcagt
gtgcctgagaagaaggagtgtgttgtaaaagacaatgactttgagcccagagccctgaaa
gctaatggagaagttattattgaaatcccaacaagagcttgtgaaccacaagagaatgct
atcaagtcactggaacatgtgcaatttgaagcaacaattgagtattcccgcagaggagac
ctccatgtcaccctcacttctgctgctggaaccggcactgtactgttggcagaaagagag
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcatacatgggga
gagaatcccataggcacttggactttgcgaattacagacatgtctggaagaatgcaaaat
gaaggcagaatcgtgaactggaagctgattctgcatggcacctcttcccagccagaacac
atgaaacagccccgagtgtacacgtcctacaacacggtgcagaatgatcgcagaggcgtg
gagaaggtggtggattccgaggaggagcagcccacacaggagaacctgaatgagagccct
ctggtatccaaaagccccagtggcagcagtgtggggggccgaagggaagagctggcagag
ggtgccccatctgaggccatgctccgactcctgcaaagtgctttcagcaaaaactctgcc
ccaaagcaatcaccaaagaaatctgcaagtgtgaagctcaacattccttacgaaaatttc
tatgaagccctggaaaagctgaaccaaccttctcagcttaaagactctgaggacagtctg
tataacgactatgtggatgttttctacaacacgaagccttacaagcacagggacgaccgg
ctgctacaagctctggtggacattctaagggaggaaaattaa

DBGET integrated database retrieval system