KEGG   Sus scrofa (pig): 397115Help
Entry
397115            CDS       T01009                                 

Gene name
ARG1
Definition
arginase, liver (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ssc00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ssc05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 322 aa AA seqDB search
MSFKSQSIGIIGAPFSKGQPRGGVEEGPTALRKAGLLEKLKEQECDVKDYGDLCFADVPN
DTPFQIVKNPRSVGKANQQLADVVAEIKKNGRTSLVLGGDHSMAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTTTGNLHGQPVSFLLKELKEKIPEVPGLSWVTPCLSAKDIVYIGLR
DVDPAEHYILKTLGIKYFSMIEVDKLGIGKVMEEAFSYLLGRKKRPIHLSFDVDGLDPFF
TPATGTPVHGGLSYREGIYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVALV
LACFGVAREGNHKPIDYLKPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaagtcacaatccatcgggatcatcggagctcctttctccaagggtcagcca
cgaggaggggtggaagaaggccctacagcattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaagattacggggacctgtgctttgctgatgtccctaat
gacactccctttcaaatagtgaagaatccaaggtctgtgggaaaagcaaatcaacagctg
gctgatgtggtggcagaaatcaagaagaacggaaggaccagccttgtactgggcggagac
cacagtatggcgattggcagcatctctggccatgccagggtccacccagatctctgtgtc
atttgggtggatgctcacaccgacatcaacactccactgacaaccacgaccgggaactta
catggacagcctgtgtcttttctcctgaaggaactaaaggaaaagattcccgaggtccca
ggactttcctgggtgactccctgcctatctgccaaagatattgtgtatattggcctgaga
gacgtggaccctgcagaacactatattttgaaaactctgggcattaaatacttttcaatg
attgaagtggataagctgggaattggcaaggtgatggaagaagcattcagctatctacta
ggaagaaagaaaaggccaattcatttgagctttgatgtggatggactggatccatttttc
acaccggccactggcacaccagtccatggaggtctgtcttatagagaaggtatctacatc
acggaagaaatttacaaaacagggctactgtcaggattagatatcatggaagtgaatcca
tctctggggaagacaccagaagaagtaactcggacggtgaacacggcagtagcactggtc
ttggcttgttttggagttgctcgggagggtaaccataagcctattgattacctgaaacca
cctaagtaa

DBGET integrated database retrieval system