KEGG   Sus scrofa (pig): 397119Help
Entry
397119            CDS       T01009                                 

Gene name
PLCD4
Definition
phospholipase C, delta 4 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    397119 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    397119 (PLCD4)
   04070 Phosphatidylinositol signaling system
    397119 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    397119 (PLCD4)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     397119 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 772 aa AA seqDB search
MASLLQGLSASPGSGLPINQDLLLMQKGMLMRKVRSKSWKKLRYYRLQDDGMTVWHARQA
GGRAKPSFSISDVETVRGGHESELLRNLAEEFPLEQGFTIVFHGRRSNLDLVANSVEEAQ
VWMQGLQLLVDFVTNMDQQERLDQWLSDWFQRGDKNQDGRMSFGEVQRLLHLMNVEMDQE
HAFQLFQTADTSQSGTLEGEEFVEFYKSLTKRAEVQELFENFSSDGQKLTLLEFVDFLQE
EQKEGERASDLALELIDRHEPSDSGKLRHVLSLDGFLSYLCSKDGDIFNPTCLPIYQDMT
QPLNHYFINSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDIWDGPNGEPVVYHGHT
LTSRIPFKDVVAAIAQYAFQTSDYPVILSLENHCSWEQQEMIAHHLTEILGEQLLSTTLD
GQLPTQLPSPEELRRKILVKGKKLRTLEEDLEEEEEEPEESELEGEQEAELELEAQFESE
PQELSPRSKDKKKKVKAILCPALSALVVYLKAVSFYSFAHSREHYRFYEISSFSEAKAKS
LIKESGNEFVQHNTWQLSRVYPGGLRTDSSNYNPQEFWNAGCQMVAMNMQTAGLEMDLCD
GLFRQNAGCGYVLKPDFLRDAQSSFHPERPISPSKAQTLLIQVISGQQLPKVDDSKEGSI
VDPLVRVEIFGVRPDTARQETSYVENNGFNPYWGQTLCFRVLVPELALLRFVVKDYDWKS
RNDFVGQYTLPWNCMQQGYRHIHLLSKDGISLHPASIFVHICIREGIEGVES
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctgctgcaaggcctctctgcttctcctggctcagggctgcccatcaatcaa
gacctgctgctgatgcagaaaggtatgctgatgcgcaaggtgaggtccaaaagctggaag
aagctaagatactacagacttcaggacgatggcatgacagtctggcatgcccggcaggcc
ggaggcagggccaagcccagcttctcaatctccgatgtggaaacggtgcgtgggggccat
gagtctgagttgctgcgcaacctggcagaggagttccccctggagcagggcttcaccatc
gtcttccatggccgccgctccaacctggacctggtggccaacagtgttgaggaggcccag
gtctggatgcaagggctccagctattggtggactttgtcactaacatggaccaacaggag
cggctggaccaatggctgagtgattggttccagcgtggagacaaaaaccaggatgggcgg
atgagtttcggagaagtccagcggttactgcacctgatgaatgtggaaatggaccaagaa
catgccttccagcttttccagacagcagacacatcccagtctgggactctggagggagaa
gaatttgtagaattctataagtcattgactaagcgtgctgaggtgcaggaattgtttgaa
aacttttcatctgatgggcagaagctaacactgctggaatttgtggatttcctccaagag
gagcagaaagaaggagaacgtgcttctgatcttgctctggaactcatcgaccgccacgag
ccttcagatagtggcaaactgcggcacgtgctgagcctggacggcttcctcagctacctc
tgctcgaaggacggagacatcttcaatccgacctgcctccccatctaccaggatatgact
caacccctgaaccactacttcatcaactcctcccacaacacctacctagtgggggaccag
ctttgtggccagagcagcgtggagggttacatacgggccctgaaacgggggtgccgctgc
gtggaggtggatatatgggatggacctaacggggaacctgttgtttatcacggacacacc
ctgacctctcgcatcccgttcaaagatgttgtggccgctatagcacagtatgccttccag
acatcagactatccagtcatcttgtccctggagaaccactgcagctgggagcagcaggag
atgatagcacaccacctgactgagatcctgggggagcagctcctgagcaccaccttggat
gggcagcttcccactcagctgccctcccccgaggagcttcggaggaagatcttggtgaag
gggaagaagttaagaacacttgaggaggatcttgaggaagaggaggaagagccagaagag
tctgaactggagggggagcaggaggctgagctggagctggaggcccagtttgaatctgag
ccccaggagctgagccctcgcagtaaagacaaaaagaagaaagtcaaggccatcttgtgt
ccagccctctctgccctggttgtctacttgaaggcggtctcattctacagcttcgctcat
tcgagggagcactatcgcttctatgaaatatcatctttctctgaagccaaggccaagagc
ctcatcaaggagtccggcaatgagtttgtgcagcacaacacctggcagttaagccgtgtg
tatcctggtggcctgaggacagattcatccaactacaacccgcaagaattctggaatgca
ggctgccagatggtggccatgaatatgcagactgcggggcttgagatggacctctgtgat
gggctctttcgccagaacgctggctgtggctacgtgctgaagccagacttcctgcgtgac
gctcagagttccttccaccccgagaggcccatcagcccttccaaagcccagaccctccta
atccaggtaatcagtggtcagcaactccccaaagtggacgacagcaaagaggggtccatt
gtggatccactggtgagagtggagatctttggcgtccgcccagacacagcccggcaagag
accagctacgtggagaacaatggttttaatccctactgggggcagaccctctgcttccgg
gtcctggtacctgaactggccctgctgcgttttgtggtaaaagattatgactggaaatcc
cgaaacgacttcgtcggtcagtacaccctgccctggaactgcatgcagcaaggttaccgc
cacatacacctgctctccaaggatggcatcagcctccacccagcctccatcttcgtgcac
atctgcatccgggaagggatagagggggttgaatcttaa

DBGET integrated database retrieval system