KEGG   Sus scrofa (pig): 397134Help
Entry
397134            CDS       T01009                                 

Gene name
DAO1, DAAO, DAMOX, DAO
Definition
D-amino acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    397134 (DAO1)
   00330 Arginine and proline metabolism
    397134 (DAO1)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    397134 (DAO1)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    397134 (DAO1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    397134 (DAO1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     397134 (DAO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q2.1-q2.3; 14
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYTSEPS
NPQEANWNQQTFNYLLSHIGSPNAANMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLTPR
ELDMFPDYRYGWFNTSLILEGRKYLQWLTERLTERGVKFFLRKVESFEEVARGGADVIIN
CTGVWAGVLQPDPLLQPGRGQIIKVDAPWLKNFIITHDLERGIYNSPYIIPGLQAVTLGG
TFQVGNWNEINNIQDHNTIWEGCCRLEPTLKDAKIVGEYTGFRPVRPQVRLEREQLRFGS
SNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVLEERNLLTMPPSHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggtggtgattggagcaggcgtcattgggctgtccactgccctctgcatccac
gagcgctaccactctgtcctgcagcccctcgatgtgaaggtctacgcagaccgcttcacc
ccgttcaccaccactgatgtagctgctggcctctggcagccctacacctctgagcccagc
aacccacaggaggcgaactggaaccaacagaccttcaactatctcctgagtcacatcggt
tctcccaatgctgcaaacatgggtctgaccccagtctcaggctacaacctcttccgtgaa
gctgttccggacccttactggaaagacatggtcctgggattccgaaagctgactcccaga
gaactggacatgtttcctgattatagatatggctggttcaacacatccctgattctggag
ggaaggaagtacctacagtggctgacagaaaggttaactgagaggggagtgaaattcttc
ctgaggaaggtggaatcttttgaggaggtggcaagaggtggcgctgatgtgattatcaac
tgcactggggtgtgggctggggtgctgcaaccggatcccctgctgcagccaggccggggg
cagatcattaaggtggatgccccttggctgaagaacttcattatcacccatgacctagag
agaggcatctacaactctccatacatcattccagggctgcaggcagtgacacttggaggc
accttccaggtggggaactggaatgagataaataatatccaggaccacaacaccatctgg
gaaggctgctgcagactggagcccacactgaaggatgcaaaaattgttggtgaatatact
ggcttccggccagtacgcccccaggttcggctagaaagagaacagcttcgctttggatct
tcaaacacagaggtcatccacaactatggccatggaggctatgggctcaccatccactgg
ggctgtgccctagaggtggccaagctctttgggaaagtcctggaagaaaggaatttgctc
acaatgccaccatcccacctctga

DBGET integrated database retrieval system