KEGG   Sus scrofa (pig): 397135Help
Entry
397135            CDS       T01009                                 

Gene name
CAST
Definition
(RefSeq) calpastatin
  KO
K04281  
calpastatin
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
2
AA seq 781 aa AA seqDB search
MAFASWWYKTHVSGKTSGSSSKSGEQKGSDEKKAASLGSSQPSRIQAGGTAPVTKVSPSS
ASTSKSSSMNPTETKAIPVSKQLEGPHSPNKKRHKKQAVKTEPEKKSQSTKPSVVHEKKT
QEVKPKEHPEPKSLPTHSADAGSKRAHKEKAVSRSNEQPTSEKSTKPKAKPQDPTPSDGK
LSVTGVSAASGKPAETKKDDKSLTSSVPAESKSSKPSGKSDMDAALDDLIDTLGGPEETE
EDNTTYTGPEVLDPMSSTYIEELGKREVTLPPKYRELLDKKEGIPVPPPDTSKPLGPDDA
IDALSLDLTCSSPTADGKKTEKEKSTGEVLKAQSVGVIKSAAAPPHEKKRRVEEDTMSDQ
ALEALSASLGSRKSEPELDLSSIKEIDEAKAKEEKLKKCGEDDETVPPEYRLKPAMDKDG
KPLLPEAEEKPKPLSESELIDELSEDFDQSKRKEKQSKPTEKTKESQATAPTPVGEAVSR
TSLCCVQSAPPKPATGMVPDDAVEALAGSLGKKEADPEDGKPVEDKVKEKAKEEDREKLG
EKEETIPPDYRLEEVKDKDGKTLPHKDPKEPVLPLSEDFVLDALSQDFAGPPAASSLFED
AKLSAAVSEVVSQTSAPTTHSAGPPPDTVSDDKKLDDALDQLSDSLGQRQPDPDENKPIE
DKVKEKAEAEHRDKLGERDDTIPPEYRHLLDKDEEGKSTKPPTKKPEAPKKPEAAQDPID
ALSGDFDRCPSTTETSENTTKDKDKKTASKSKAPKNGGKAKDSTKAKEETSKQKSDGKST
S
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgcaagctggtggtacaagacgcatgtcagtggaaaaaccagtggatcgtct
tccaagtcaggagaacagaaaggatcagatgagaaaaaagcagcaagccttgggagcagt
cagccctccagaattcaggctggtggaacagccccagtcaccaaggtatcgccttcctct
gcttcaacgagcaagtcttccagtatgaatcccacagaaaccaaggccattccagtcagc
aaacagctggaaggaccgcattctcccaacaagaaaagacacaaaaaacaggctgtaaaa
acagaacctgaaaagaagtcacaatcaactaagccatctgtggttcatgagaaaaaaacc
caagaagtaaagccaaaggaacacccagagccaaaaagcctacccacgcactcagcagat
gcagggagcaagcgtgctcataaagaaaaagcagtttccagatctaatgagcagccaaca
tcagagaaatcaacaaaaccaaaggctaaaccacaggacccgacccccagtgatggaaag
ctttctgttactggtgtatctgcagcatctggcaaaccagctgagacgaaaaaagatgat
aaatcattaacatcgtctgtaccagctgaatccaaatcaagtaaaccatcaggaaagtca
gatatggatgctgctttggatgacttaatagacactttaggaggacctgaagaaactgag
gaagataatacaacatatactggacctgaagttttggatccaatgagttctacctatata
gaggaattgggtaaaagagaagtcacacttcctccaaaatatagggaattgttggataaa
aaagaagggatcccagtgcctcctccagacacttcgaaacccctggggcccgatgatgcc
attgatgccttgtcattagacttgacctgcagttctcctacagctgatgggaagaaaacc
gagaaagagaaatctactggagaggttttgaaagctcagtctgttggggtaatcaaaagc
gctgctgctccaccccacgagaaaaaaagaagggtggaagaggacacgatgagtgatcaa
gcactggaggctttgtcagcttccctgggcagccggaagtcagaacccgagcttgacctc
agctccattaaggaaattgatgaggcaaaagccaaagaagagaaactaaagaagtgtggt
gaagatgacgaaacggtcccgccagagtatagattgaaaccagccatggataaagatgga
aaaccactcttgccagaggctgaagaaaaacccaagcccctgagtgaatcagaactcatt
gatgaactttcggaagattttgaccagtctaagcgtaaagaaaaacaatctaagccaact
gaaaaaacaaaagagtctcaggccactgcccctactcctgtgggagaggccgtgtctcgg
acctccttgtgctgtgtgcagtcggcacccccaaagccagctacgggcatggtgccagat
gatgctgtagaagcgcttgctggaagcctggggaaaaaggaagctgatccagaagatgga
aagcctgtggaggataaagtcaaggagaaagccaaagaagaggatcgtgaaaaacttggt
gaaaaggaagaaacgattcctcctgattatagattagaagaggtcaaggacaaagatgga
aaaactctcccgcacaaagaccccaaggaaccagtcctgcccttgagtgaagacttcgtc
cttgatgctttgtcccaggactttgccggtcccccagccgcttcatctctttttgaagat
gctaaactttcagctgccgtctctgaagtggtttcccaaacctcagctccaaccacccac
tctgcaggtccaccccctgacactgtgagtgatgacaaaaaacttgacgatgccctggat
cagctttctgacagtctggggcaaagacagcctgacccagatgagaacaagcccatagag
gataaagtcaaggaaaaagctgaagctgaacatagagacaagctgggagaaagagatgac
actatcccgcctgaatatagacatctcttggataaggatgaggagggcaaatcaacgaag
ccacccacaaagaaacctgaggcaccaaagaaacctgaagctgcccaagatcccattgat
gccctctcaggggattttgacagatgtccatcaactacagaaacctcagagaacacaaca
aaggacaaagacaagaagacggcttccaagtccaaagcacccaagaatgggggtaaagca
aaggattccacaaaggcaaaggaggaaacttccaaacaaaaatctgatggaaagagtaca
agttaa

DBGET integrated database retrieval system