KEGG   Sus scrofa (pig): 397243Help
Entry
397243            CDS       T01009                                 

Gene name
CYSLTR2, CYSLT2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
ssc  Sus scrofa (pig)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:ssc04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ssc04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 345 aa AA seqDB search
MERKLMSLLPSISLSEMEPNSTLGNHNSNRSCTTENFKREFYPIVYLVIFIWGALGNGFS
IYVFLKPYKKSTSVNVFMLNLAISDLLFTITLPFRVDYYLRGSNWIFGDTPCRIMSYSMY
VNMYSSIYFLTVLSVVRFLATVHPFRLLHTTSIKNAWILCGVIWIFIMASSTVLLKNGSE
QKDNVTLCLELNSNKVTKLKTMNYVALAVGFVLPFGTLSICYLLIIRALLKVEVPESGLR
LSHRKALITVIIALIIFLLCFLPYHVLRTLHLLEWKADKCKDRLHKAVAVTLALAAANSC
FNPFLYYFAGENFKDRLKSALRKGRPQKIRCGFSVCVWLKKETRV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaacttatgtccttacttccatccatctccctatcagaaatggaacccaat
agtaccttgggcaatcacaatagcaacaggagctgcaccacagaaaacttcaagagagaa
ttttaccccattgtgtacctagtaatatttatctggggagccttgggaaatggcttttct
atatatgttttcctgaaaccttataagaagtccacatcagtcaatgttttcatgctaaat
ctggccatttcggatctcttattcacaatcacactgcccttcagggttgactattacctt
agaggctccaactggatatttggggacacaccttgcaggattatgtcttattctatgtat
gtcaacatgtacagcagcatttatttcctgactgtgctgagtgttgtgcgtttcctggca
actgttcaccccttccggctccttcataccaccagcatcaagaacgcctggattctctgt
ggggtcatatggatctttattatggcttcctcaacagtacttctgaagaatggctctgag
cagaaagacaatgtcacattgtgcttagagctgaattctaataaagttactaaactgaag
accatgaactacgttgccttggcggtgggctttgtgctgccattcggcactctcagcatc
tgctacctgctaatcattcgagctttgttaaaggtagaggtcccggagtccgggctgcgg
ctttctcacaggaaggcattgatcaccgtcatcattgctttgatcatctttctcctgtgt
ttcctgccctatcacgtactgagaacccttcacctgctcgaatggaaagctgataaatgc
aaagacaggctgcataaagctgtggctgtcacactagctttggcagcggccaacagctgc
ttcaatcctttcctctattactttgctggggagaattttaaggacagactaaagtctgca
ctcaggaaaggtcgaccacagaaaataaggtgcggtttctctgtctgtgtgtggctgaaa
aaggaaacgagagtgtaa

DBGET integrated database retrieval system