KEGG   Sus scrofa (pig): 397243Help
Entry
397243            CDS       T01009                                 

Gene name
CYSLTR2, CYSLT2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
ssc  Sus scrofa (pig)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    397243 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397243 (CYSLTR2)
G protein-coupled receptors [BR:ssc04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    397243 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 345 aa AA seqDB search
MERKLMSLLPSISLSEMEPNSTLGNHNSNRSCTTENFKREFYPIVYLVIFIWGALGNGFS
IYVFLKPYKKSTSVNVFMLNLAISDLLFTITLPFRVDYYLRGSNWIFGDTPCRIMSYSMY
VNMYSSIYFLTVLSVVRFLATVHPFRLLHTTSIKNAWILCGVIWIFIMASSTVLLKNGSE
QKDNVTLCLELNSNKVTKLKTMNYVALAVGFVLPFGTLSICYLLIIRALLKVEVPESGLR
LSHRKALITVIIALIIFLLCFLPYHVLRTLHLLEWKADKCKDRLHKAVAVTLALAAANSC
FNPFLYYFAGENFKDRLKSALRKGRPQKIRCGFSVCVWLKKETRV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaacttatgtccttacttccatccatctccctatcagaaatggaacccaat
agtaccttgggcaatcacaatagcaacaggagctgcaccacagaaaacttcaagagagaa
ttttaccccattgtgtacctagtaatatttatctggggagccttgggaaatggcttttct
atatatgttttcctgaaaccttataagaagtccacatcagtcaatgttttcatgctaaat
ctggccatttcggatctcttattcacaatcacactgcccttcagggttgactattacctt
agaggctccaactggatatttggggacacaccttgcaggattatgtcttattctatgtat
gtcaacatgtacagcagcatttatttcctgactgtgctgagtgttgtgcgtttcctggca
actgttcaccccttccggctccttcataccaccagcatcaagaacgcctggattctctgt
ggggtcatatggatctttattatggcttcctcaacagtacttctgaagaatggctctgag
cagaaagacaatgtcacattgtgcttagagctgaattctaataaagttactaaactgaag
accatgaactacgttgccttggcggtgggctttgtgctgccattcggcactctcagcatc
tgctacctgctaatcattcgagctttgttaaaggtagaggtcccggagtccgggctgcgg
ctttctcacaggaaggcattgatcaccgtcatcattgctttgatcatctttctcctgtgt
ttcctgccctatcacgtactgagaacccttcacctgctcgaatggaaagctgataaatgc
aaagacaggctgcataaagctgtggctgtcacactagctttggcagcggccaacagctgc
ttcaatcctttcctctattactttgctggggagaattttaaggacagactaaagtctgca
ctcaggaaaggtcgaccacagaaaataaggtgcggtttctctgtctgtgtgtggctgaaa
aaggaaacgagagtgtaa

DBGET integrated database retrieval system