KEGG   Sus scrofa (pig): 397449Help
Entry
397449            CDS       T01009                                 

Gene name
CREB1
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:ssc04668]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:ssc04612]
Organismal Systems; Endocrine system; Insulin secretion [PATH:ssc04911]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:ssc04915]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:ssc04918]
Organismal Systems; Endocrine system; Melanogenesis [PATH:ssc04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:ssc04261]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:ssc04962]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:ssc04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:ssc04728]
Organismal Systems; Development; Osteoclast differentiation [PATH:ssc04380]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:ssc04710]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:ssc04713]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ssc05203]
Human Diseases; Cancers; Prostate cancer [PATH:ssc05215]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:ssc05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:ssc05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:ssc05031]
Human Diseases; Substance dependence; Alcoholism [PATH:ssc05034]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ssc05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ssc05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:ssc05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 327 aa AA seqDB search
MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTGTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagcagacaaccagcagagtggagatgctgctgtaacagaagct
gaaaatcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcatgcaacatcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggcgttatccaggcggcccagccatcagttatccagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcacaggagtct
gtggatagtgtaactgattcccaaaaacgaagggaaatcctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggggtgccaaggattgaagaagaa
aagtcagaagaggagacttcagcccctgccatcaccactgtaacagtgccaacccccatt
taccaaactagcagtggacagtatattgccattacccagggaggagcaattcagctggcc
aacaatggtaccgatggggtacaaggcctgcagacattaaccatgaccaatgcagctgcc
actcagccgggtactaccatcctacagtatgcccagaccactgatggacagcagatcttg
gtgcccagcaaccaagttgttgttcaagctgcctctggagatgtacagacataccaaatt
cgcacagcacccactggcaccattgccccgggagttgttatggcatcctctccagcactt
cccacacagcctgctgaagaagcagcgcgaaagagagaggtccgcctaatgaagaacagg
gaagcagcacgagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagaaaacaga
gtggcagtgcttgaaaaccaaaacaagacactgattgaggagctcaaagcacttaaggac
ctttactgccacaaatcagattaa

DBGET integrated database retrieval system