KEGG   Sus scrofa (pig): 397476Help
Entry
397476            CDS       T01009                                 

Gene name
PCPA1, CPA1
Definition
carboxypeptidase A1 precursor (EC:3.4.17.1)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    397476 (PCPA1)
   04974 Protein digestion and absorption
    397476 (PCPA1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     397476 (PCPA1)
Peptidases [BR:ssc01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   397476 (PCPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 419 aa AA seqDB search
MWGLLIFSVLLGGVLAKEDFVGHQVLRISVDDEAQVQKVKELEDLEHLQLDFWRGPARPG
FPIDVRVPFPSIQAVKVFLEAHGIRYTIMIEDVQLLLDEEQEQMFASQGRARTTSTFNYA
TYHTLEEIYDFMDILVAEHPQLVSKLQIGSSYEGRPIYVLKFSTGGNNRPAIWIDTGIHS
REWVTQASGVWFAKKITEDYGQDPAFTAILDNLDIFLEIVTNPDGFAFTHSENRMWRKTR
SRTSGSFCVGVDPNRNWDAGFGGAGASSNPCSETYHGKFPNSEVEVKSIVDFVNDHGNIK
AFISIHSYSQLLLYPYGYKTEAPADKDELDQISKSAVAALTSLYGTKFQYGSIITTIYQA
SGGTIDWTYNQGIKYSFSFELRDTGRYGFLLPASQIIPTAQETWLALLTIMEHTLNHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggctgctgatttttagtgtattattggggggtgtccttgccaaagaggatttt
gtggggcatcaggtgctccgaatctctgtggatgatgaagcccaggtacagaaggtgaag
gagctggaggacctggagcacttgcagctggacttctggcggggccctgccaggccaggc
ttccccatcgacgtccgagtgcccttccccagcatccaggctgtcaaagtsttcctggag
gcccatggcatcagatataccatcatgatcgaggatgtgcagttgctgctggatgaggag
caggagcagatgttcgcttcccagggccgagcccgcaccaccagcacctttaactacgcc
acctaccacaccctggaggagatctatgacttcatggacatactggtggccgagcaccca
cagcttgtcagcaagctccagattggcagcagctatgaaggccgccccatctacgtgctg
aagttcagcactgggggaaacaaccgtccggctatctggattgacacgggcatccattcc
cgggagtgggtcacccaggccagtggggtctggtttgcaaagaagatcactgaagactat
ggccaggacccggctttcaccgccattcttgacaacttggacatcttcctggagattgtc
actaaccctgacggttttgcctttacccacagtgagaatcgaatgtggcgcaagactcga
tcccgcacgtcgggctctttctgtgttggggtggaccccaacaggaactgggatgccggc
tttgggggggcaggagccagcagcaacccatgctcggaaacttaccatggcaagtttccc
aattctgaagtggaagtcaagtccatcgtggactttgtgaacgaccatggaaacatcaag
gccttcatctccatccacagctactcccagctcctcctctatccctatggctacaaaaca
gaagcacctgcggacaaggatgagctggatcagatatctaagtctgctgttgccgccctg
acctctctgtatgggaccaagttccagtatggcagcatcatcactacaatttaccaagcc
agtggaggcaccattgactggacgtacaaccagggcatcaagtactccttctccttcgag
ctccgggacactgggcgctatggcttcctgttgccagcctcccagatcatccccacagcc
caggagacatggctggcacttctgaccatcatggagcacactctgaatcacccctactga

DBGET integrated database retrieval system