KEGG   Sus scrofa (pig): 397478Help
Entry
397478            CDS       T01009                                 

Gene name
CES1, APLE, PMPMEase, REH, TGH
Definition
carboxylesterase 1 (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    397478 (CES1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     397478 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 565 aa AA seqDB search
MWLLPLVLTSLASSATWGQPASPPVVDTAQGRVLGKYVSLEGLAQPVAVFLGVPFAKPPL
GSLRFAPPQPAEPWSFVKNTTSYPPMCCQDPVAGQMTSDLFTNGKERLIPEFSEDCLYLN
IYTPADLTRRGRLPVMVWIHGGGLVVGGASTYDGLALAAHENVVVVAIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALHWVQENIANFGGDTGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTAGLVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLKM
KFLTLDLHGDPRESHPFLPTVVDGVLLPKMPEEILAEKDFNTVPYIVGINKQEFGWLLPT
MMGFPLSEGKLDQKTATSLLWKSFPITNIPEELTPVATDKYLGGTDDPVKKKDLFLDLMG
DVVFGVPSVTVARQHRDAGAPTYMYEFQYRPSFSSDKKPKTVIGDHGDEIFSVFGFPLLK
GDAPEEEVSLSKTVMKFWANFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGE
EVAFWNDLLSKEAAKKPPKIKHAEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttctcccgctggtcctgacctccctcgcctcttctgcaacttgggggcagcca
gcctcgccgcctgttgtggacactgcccagggccgagtcctggggaagtacgtcagctta
gaaggcctggcacagccggtggccgtcttcctgggagtcccttttgccaagccccctctc
ggatccttgaggtttgctccgccgcagcctgcagaaccatggagcttcgtgaagaacacc
acctcctaccctcccatgtgctgccaggacccagtagcggggcagatgacctcagatcta
tttaccaacggaaaggagaggctcattccggagttttctgaagactgtctctacctaaat
atttacacccctgctgacctgacaaggaggggcagactgccggtgatggtgtggatccac
ggaggaggtctggtggtgggcggggcttccacctatgatggactggccctcgctgcgcat
gaaaacgtggtggtggtggccatccagtaccgcctgggcatctggggattcttcagcaca
ggggacgaacacagccggggcaactggggtcacttggaccaggtggccgcactgcactgg
gtccaggagaacatcgccaactttggaggcgacacaggctctgtgaccatctttggagag
tcagcaggaggggaaagtgtctctgttctggtgttgtctcccttggccaagaacctcttc
caccgggccatctctgagagtggcgtggccctcactgctggcctggtcaggaaggacatg
aaggctgcagctaagcaaattgctgtccttgctgggtgtaaaaccaccacctcggctgtc
tttgttcactgcctgcgccagaagtcggaggacgagctcttggacttaacgctgaagatg
aaatttttaactcttgatttgcatggagaccccagagagagccatcccttcctgcccact
gtggtggatggagtgctgctgcccaagatgcctgaagagattctggctgaaaaggatttc
aacactgtcccctacatcgtgggaatcaacaagcaagagtttggctggcttctgccaacg
atgatgggcttccccctctctgaaggcaagctggaccagaagacggccacgtcactcctg
tggaagtcattccccatcactaacatccctgaggaactgactccagtggccactgacaag
tatttgggggggacagacgaccccgtcaaaaagaaagacctgttcctggacttgatgggg
gatgtggtgtttggtgtcccatctgtgacggtggcccgtcaacacagagatgcaggagcc
cccacctacatgtatgagtttcagtatcgcccaagcttctcatcggacaagaaacccaag
acggtgatcggggaccacggggatgagatcttctccgtctttggttttccactgttaaaa
ggcgatgccccagaagaggaggtcagtctcagcaagacggtgatgaaattctgggccaac
tttgctcgcagtgggaaccccaatggggaggggctgccccattggccgatgtacgaccag
gaagaagggtaccttcagatcggcgtcaacacccaggcagccaagaggctgaaaggtgaa
gaagtggccttctggaacgatctcctgtccaaggaggcagcaaagaagccacccaagata
aagcatgctgagctgtga

DBGET integrated database retrieval system