KEGG   Sus scrofa (pig): 397495Help
Entry
397495            CDS       T01009                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ssc04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:ssc04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:ssc05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:ssc05030]
Human Diseases; Substance dependence; Alcoholism [PATH:ssc05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 252 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANVRGQGSLAYPGVRTHGTLESVNGPKAGSRGLTSSS
SSSLADTFEHVIEELLDEDQKVRPNEENNKDADMYTSRVMLSSQVPLEPPLLFLLEEYKN
YLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKG
QLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDT
SCVCTLTIKRGR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagccaacgtccgaggacaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccaaggcaggttcaagaggcctgacatcgtcgtca
tcgtcgtcgttggcggacacttttgaacacgtgatcgaggagctgttggacgaggaccag
aaagttcggcccaatgaggaaaacaataaggacgcggacatgtatacgtcccgagtcatg
ctcagcagtcaagtgcctttggagcctcctcttctctttctgctggaggaatacaaaaat
tacctggatgctgcaaacatgtccatgagggtccggcgccactcggaccccgcccgccgc
ggggagctgagcgtgtgcgacagcattagcgagtgggtgacggcggcggataaaaagacg
gcagtggacatgtcgggtggcacggtcacggtcctcgaaaaagtccccgtctcgaaaggc
caactgaagcagtacttctacgagaccaagtgcaatcctatggggtacacaaaggagggc
tgcaggggcatagacaagaggcactggaactcccagtgccgaactacccagtcgtatgtg
cgggccctcaccatggatagcaaaaaacgaattggctggcggttcataaggatagacact
tcctgtgtatgtactttgaccattaagaggggaagatag

DBGET integrated database retrieval system