KEGG   Sus scrofa (pig): 397495Help
Entry
397495            CDS       T01009                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    397495 (BDNF)
   04024 cAMP signaling pathway
    397495 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    397495 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    397495 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    397495 (BDNF)
   05034 Alcoholism
    397495 (BDNF)
Cytokines [BR:ssc04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    397495 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 252 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANVRGQGSLAYPGVRTHGTLESVNGPKAGSRGLTSSS
SSSLADTFEHVIEELLDEDQKVRPNEENNKDADMYTSRVMLSSQVPLEPPLLFLLEEYKN
YLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKG
QLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDT
SCVCTLTIKRGR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagccaacgtccgaggacaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccaaggcaggttcaagaggcctgacatcgtcgtca
tcgtcgtcgttggcggacacttttgaacacgtgatcgaggagctgttggacgaggaccag
aaagttcggcccaatgaggaaaacaataaggacgcggacatgtatacgtcccgagtcatg
ctcagcagtcaagtgcctttggagcctcctcttctctttctgctggaggaatacaaaaat
tacctggatgctgcaaacatgtccatgagggtccggcgccactcggaccccgcccgccgc
ggggagctgagcgtgtgcgacagcattagcgagtgggtgacggcggcggataaaaagacg
gcagtggacatgtcgggtggcacggtcacggtcctcgaaaaagtccccgtctcgaaaggc
caactgaagcagtacttctacgagaccaagtgcaatcctatggggtacacaaaggagggc
tgcaggggcatagacaagaggcactggaactcccagtgccgaactacccagtcgtatgtg
cgggccctcaccatggatagcaaaaaacgaattggctggcggttcataaggatagacact
tcctgtgtatgtactttgaccattaagaggggaagatag

DBGET integrated database retrieval system