KEGG   Sus scrofa (pig): 397504Help
Entry
397504            CDS       T01009                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04371  Apelin signaling pathway
ssc04530  Tight junction
ssc04710  Circadian rhythm
ssc04714  Thermogenesis
ssc04910  Insulin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease (NAFLD)
ssc05410  Hypertrophic cardiomyopathy (HCM)
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    397504 (PRKAA2)
   04068 FoxO signaling pathway
    397504 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    397504 (PRKAA2)
   04152 AMPK signaling pathway
    397504 (PRKAA2)
   04150 mTOR signaling pathway
    397504 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    397504 (PRKAA2)
  Cellular community - eukaryotes
   04530 Tight junction
    397504 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    397504 (PRKAA2)
   04922 Glucagon signaling pathway
    397504 (PRKAA2)
   04920 Adipocytokine signaling pathway
    397504 (PRKAA2)
   04921 Oxytocin signaling pathway
    397504 (PRKAA2)
  Aging
   04211 Longevity regulating pathway - mammal
    397504 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    397504 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    397504 (PRKAA2)
   04714 Thermogenesis
    397504 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    397504 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    397504 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    397504 (PRKAA2)
   04931 Insulin resistance
    397504 (PRKAA2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     397504 (PRKAA2)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   397504 (PRKAA2)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Other autophagy associated proteins
   Others
    397504 (PRKAA2)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    397504 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    397504 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 397504
NCBI-ProteinID: NP_999431
Ensembl: ENSSSCG00000003837
UniProt: Q28948 C9W108
Position
6
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVLEQR
SGSSTPQRSCSAAGLHRPRSSLDSVTAESHSLSGSLSGSLTGSMLPSVPPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagattggacactacgtgctgggggac
acgctgggtgtcggcaccttcggcaaagtgaagattggagagcatcaactgacaggccat
aaagtggcagttaaaattttaaataggcagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactcttccgtcatcctcatattatcaaactatac
caggtgatcagcactccgacagatttttttatggtaatggaatatgtgtctggtggtgaa
ttatttgattacatctgtaaacatggacgggttgaagagatggaagccaggcggctcttt
cagcagattctctctgccgtggattactgtcacaggcatatggttgttcatcgagacctg
aaaccagagaatgtgctattggatgcacagatgaatgccaagatagcagattttggatta
tctaatatgatgtcagatggtgagtttctgcgaactagttgtgggtctccaaattacgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaggtcgatatctggagctgc
ggtgttattttgtatgctcttctttgtggcacactcccatttgatgatgagcatgtgcct
acattgtttaagaagatccgagggggtgttttttatattccagaatatctcaatcgttct
gttgccactctcctgatgcatatgctgcaggttgaccccctgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttgtatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttgtcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcttttatggatgatagtgccatgcatattccc
ccaggcctgaaacctcatccagaaaggatgccacctcttatagcagacagccctaaagca
agatgtccattggatgcactgaatacaaccaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttgggattcgaagtcaaagcaaaccatatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatctacgtgta
agaagaaaaaatccagtgactggcaattatgtgaaaatgagcttacagttgtacctggtt
gacaatagaagctatcttttggactttaaaagcattgatgatgaggtgctggagcagagg
tctggttcctcaacacctcagcggtcctgctctgctgctggcttgcacagaccgcggtca
agcttggattctgtcactgcggagagccactcactctctggctctctctctggctccttg
accggaagcatgctgccttcagttccacctcgcctgggcagtcacaccatggattttttc
gaaatgtgtgccagtctgatcactactttagcccgttga

DBGET integrated database retrieval system