KEGG   Sus scrofa (pig): 397504Help
Entry
397504            CDS       T01009                                 

Gene name
PRKAA2, AMPKA2
Definition
protein kinase, AMP-activated, alpha 2 catalytic subunit (EC:2.7.11.1 2.7.11.27 2.7.11.31)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ssc  Sus scrofa (pig)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    397504 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    397504 (PRKAA2)
   04152 AMPK signaling pathway
    397504 (PRKAA2)
   04150 mTOR signaling pathway
    397504 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    397504 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    397504 (PRKAA2)
   04920 Adipocytokine signaling pathway
    397504 (PRKAA2)
   04921 Oxytocin signaling pathway
    397504 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    397504 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    397504 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    397504 (PRKAA2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     397504 (PRKAA2)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   397504 (PRKAA2)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    397504 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    397504 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVLEQR
SGSSTPQRSCSAAGLHRPRSSLDSVTAESHSLSGSLSGSLTGSMLPSVPPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagattggacactacgtgctgggggac
acgctgggtgtcggcaccttcggcaaagtgaagattggagagcatcaactgacaggccat
aaagtggcagttaaaattttaaataggcagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactcttccgtcatcctcatattatcaaactatac
caggtgatcagcactccgacagatttttttatggtaatggaatatgtgtctggtggtgaa
ttatttgattacatctgtaaacatggacgggttgaagagatggaagccaggcggctcttt
cagcagattctctctgccgtggattactgtcacaggcatatggttgttcatcgagacctg
aaaccagagaatgtgctattggatgcacagatgaatgccaagatagcagattttggatta
tctaatatgatgtcagatggtgagtttctgcgaactagttgtgggtctccaaattacgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaggtcgatatctggagctgc
ggtgttattttgtatgctcttctttgtggcacactcccatttgatgatgagcatgtgcct
acattgtttaagaagatccgagggggtgttttttatattccagaatatctcaatcgttct
gttgccactctcctgatgcatatgctgcaggttgaccccctgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttgtatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttgtcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcttttatggatgatagtgccatgcatattccc
ccaggcctgaaacctcatccagaaaggatgccacctcttatagcagacagccctaaagca
agatgtccattggatgcactgaatacaaccaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttgggattcgaagtcaaagcaaaccatatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatctacgtgta
agaagaaaaaatccagtgactggcaattatgtgaaaatgagcttacagttgtacctggtt
gacaatagaagctatcttttggactttaaaagcattgatgatgaggtgctggagcagagg
tctggttcctcaacacctcagcggtcctgctctgctgctggcttgcacagaccgcggtca
agcttggattctgtcactgcggagagccactcactctctggctctctctctggctccttg
accggaagcatgctgccttcagttccacctcgcctgggcagtcacaccatggattttttc
gaaatgtgtgccagtctgatcactactttagcccgttga

DBGET integrated database retrieval system