KEGG   Sus scrofa (pig): 397504Help
Entry
397504            CDS       T01009                                 

Gene name
PRKAA2, AMPKA2
Definition
protein kinase, AMP-activated, alpha 2 catalytic subunit (EC:2.7.11.1 2.7.11.27 2.7.11.31)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ssc  Sus scrofa (pig)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ssc04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:ssc04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:ssc04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ssc04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:ssc04920]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:ssc04921]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:ssc04710]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:ssc05410]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:ssc04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVLEQR
SGSSTPQRSCSAAGLHRPRSSLDSVTAESHSLSGSLSGSLTGSMLPSVPPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagattggacactacgtgctgggggac
acgctgggtgtcggcaccttcggcaaagtgaagattggagagcatcaactgacaggccat
aaagtggcagttaaaattttaaataggcagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactcttccgtcatcctcatattatcaaactatac
caggtgatcagcactccgacagatttttttatggtaatggaatatgtgtctggtggtgaa
ttatttgattacatctgtaaacatggacgggttgaagagatggaagccaggcggctcttt
cagcagattctctctgccgtggattactgtcacaggcatatggttgttcatcgagacctg
aaaccagagaatgtgctattggatgcacagatgaatgccaagatagcagattttggatta
tctaatatgatgtcagatggtgagtttctgcgaactagttgtgggtctccaaattacgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaggtcgatatctggagctgc
ggtgttattttgtatgctcttctttgtggcacactcccatttgatgatgagcatgtgcct
acattgtttaagaagatccgagggggtgttttttatattccagaatatctcaatcgttct
gttgccactctcctgatgcatatgctgcaggttgaccccctgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttgtatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttgtcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcttttatggatgatagtgccatgcatattccc
ccaggcctgaaacctcatccagaaaggatgccacctcttatagcagacagccctaaagca
agatgtccattggatgcactgaatacaaccaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttgggattcgaagtcaaagcaaaccatatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatctacgtgta
agaagaaaaaatccagtgactggcaattatgtgaaaatgagcttacagttgtacctggtt
gacaatagaagctatcttttggactttaaaagcattgatgatgaggtgctggagcagagg
tctggttcctcaacacctcagcggtcctgctctgctgctggcttgcacagaccgcggtca
agcttggattctgtcactgcggagagccactcactctctggctctctctctggctccttg
accggaagcatgctgccttcagttccacctcgcctgggcagtcacaccatggattttttc
gaaatgtgtgccagtctgatcactactttagcccgttga

DBGET integrated database retrieval system