KEGG   Sus scrofa (pig): 397510Help
Entry
397510            CDS       T01009                                 

Gene name
UOX
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ssc  Sus scrofa (pig)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    397510 (UOX)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    397510 (UOX)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     397510 (UOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 304 aa AA seqDB search
MAHYRNDYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHG
DNSDVIPTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRF
EKNGVKHVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTT
LPEVKDRCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLY
DIQVLTLGQVPEIEDMEISLPNIHYLNIDMSKMGLINKEEVLLPLDNPYGRITGTVKRKL
TSRL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctcattaccgtaatgactacaaaaagaatgatgaggtagagtttgtccgaactggc
tatgggaaggatatgataaaagttctccatattcagcgagatggaaaatatcacagcatt
aaagaggtggcaacttcagtgcaactgactttgagctccaaaaaagattacctgcatgga
gacaattcagatgtcatccctacagacaccatcaagaacacagttaatgtcctggcgaag
ttcaaaggcatcaaaagcatagaaacttttgctgtgactatctgtgagcatttcctttct
tccttcaagcatgtcatcagagctcaagtctatgtggaagaagttccttggaagcgtttt
gaaaagaatggagttaagcatgtccatgcatttatttatactcctactggaacgcacttc
tgtgaggttgaacagataaggaatggacctccagtcattcattctggaatcaaagaccta
aaagtcttgaaaacaacccagtctggctttgaaggattcatcaaggaccagttcaccacc
ctccctgaggtgaaggaccggtgctttgccacccaagtgtactgcaaatggcgctaccac
cagggcagagatgtggactttgaggccacctgggacactgttaggagcattgtcctgcag
aaatttgctgggccctatgacaaaggcgagtactcgccctctgtccagaagacactctat
gacatccaggtgctcaccctgggccaggttcctgagatagaagatatggaaatcagcctg
ccaaatattcactacttaaacatagacatgtccaaaatgggactgatcaacaaggaagag
gtcttgctacctttagacaatccatatggcaggattactggtacagtcaagaggaagctg
acttcaaggctgtga

DBGET integrated database retrieval system