KEGG   Sus scrofa (pig): 397536Help
Entry
397536            CDS       T01009                                 

Gene name
BCL2L1
Definition
BCL2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
ssc  Sus scrofa (pig)
Pathway
Ras signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ssc04014]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:ssc04630]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:ssc04064]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Cellular Processes; Cell growth and death; Apoptosis [PATH:ssc04210]
Human Diseases; Cancers; Pathways in cancer [PATH:ssc05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:ssc05202]
Human Diseases; Cancers; Pancreatic cancer [PATH:ssc05212]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:ssc05220]
Human Diseases; Cancers; Small cell lung cancer [PATH:ssc05222]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:ssc05014]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ssc05166]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ssc05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttactgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagaagcggaaacccctagtgccatcaatggcaacccatcctggcacctggcg
gacagccccgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggctgcagtgaagcaagcgctgagggaggcgggcgatgagtttgaactgagg
taccggagggcattcagtgacctgacgtcccagctccacatcaccccagggacagcgtat
cagagctttgagcaggtattgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacggaaacaatgcagca
gctgagagccggaagggccaggaacgcttcaaccgatggttcctgacgggcatgactcta
gctggggtggttctgctgggttcgctcttcagtcggaaatga

DBGET integrated database retrieval system