KEGG   Sus scrofa (pig): 397537Help
Entry
397537            CDS       T01009                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase precursor
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00561  Glycerolipid metabolism
ssc01100  Metabolic pathways
ssc03320  PPAR signaling pathway
ssc04979  Cholesterol metabolism
ssc05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    397537 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    397537 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    397537 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    397537 (LPL)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     397537 (LPL)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   397537 (LPL)
  Exosomal proteins of breast milk
   397537 (LPL)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   397537 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
 Enzymes
  397537 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 397537
NCBI-ProteinID: NP_999451
UniProt: P49923
Position
14
AA seq 478 aa AA seqDB search
MESKALLLVALSVWLQSLIVSREGLATADRISGGRDFTDIESKFALRTPEDTVEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPISAGYTKLVGQDVATFIDWMAVEFSYPPNNVHLLGYSLGAHAAGIAGSLTKKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRAQMPYKVFHYQVKMRFSGTESDTH
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWVSDSYFSW
SNWWSSPGFAIEKIRVKAGETQKKVIFCSREKKSHLQKGKSSVVFVKCHDKSLNRKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctagtggctctgagcgtgtggcttcagagtctgatcgtc
tcccgcgaagggttggccaccgccgacagaatttcaggaggaagagattttacagacatc
gaaagtaaatttgctctcaggactcctgaagacacagttgaggacacttgccatctcatt
cctggagtgacagaatctgtggctaactgtcatttcaaccatagcagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgaaagttgggtccccaaacttgtggct
gccctatacaagagggaaccggattccaacgtcattgtggtggactggctgtctcgggcc
cagcagcattatccaatatctgcgggatacaccaagctggtgggacaggatgtggccacg
tttatcgactggatggcggttgaatttagctatcctcccaacaatgtccacctcctggga
tacagccttggagcccacgctgctggcattgcaggaagtctgaccaagaagaaggtcaat
agaattactggcctagatccagctggacctaacttcgagtatgcagaagctccaagccgc
ctttctcccgacgacgcagattttgtagacgtcttacacacattcaccagagggtcacct
ggccgaagtattggcatccagaaaccagtagggcatgttgacatttatcccaatggaggc
actttccaaccagggtgtaacattggagaagccatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctcgtgaagtgctcccatgagcgctccatccatctcttcatcgac
tctctgttgaatgaagaaaatcctagtaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctctgcctgagttgcagaaagaaccgttgcaacaacttgggctatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcgtgctcagatgccc
tacaaagtcttccattaccaagtaaagatgcgtttttctgggactgagagtgatacccac
accaaccaggcctttgagatctctctatatggcaccgtggccgagagtgaaaacatccct
ttcaccctgcctgaagtctccacaaataagacatactcctttctaatttacacagaggtg
gatattggagagttgctaatgttgaaactcaaatgggtcagtgattcatacttcagctgg
tccaactggtggagcagccctggctttgctattgagaagatcagagtgaaggcaggagag
actcaaaaaaaggtgatcttctgttcccgggagaagaagtctcacctgcagaaaggaaag
tcctctgtggtgtttgtgaaatgccacgacaagtctctgaatagaaagtctggctga

DBGET integrated database retrieval system