KEGG   Sus scrofa (pig): 397537Help
Entry
397537            CDS       T01009                                 

Gene name
LPL
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssc00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ssc03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:ssc05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14q12-q14; 14
AA seq 478 aa AA seqDB search
MESKALLLVALSVWLQSLIVSREGLATADRISGGRDFTDIESKFALRTPEDTVEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPISAGYTKLVGQDVATFIDWMAVEFSYPPNNVHLLGYSLGAHAAGIAGSLTKKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRAQMPYKVFHYQVKMRFSGTESDTH
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWVSDSYFSW
SNWWSSPGFAIEKIRVKAGETQKKVIFCSREKKSHLQKGKSSVVFVKCHDKSLNRKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctagtggctctgagcgtgtggcttcagagtctgatcgtc
tcccgcgaagggttggccaccgccgacagaatttcaggaggaagagattttacagacatc
gaaagtaaatttgctctcaggactcctgaagacacagttgaggacacttgccatctcatt
cctggagtgacagaatctgtggctaactgtcatttcaaccatagcagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgaaagttgggtccccaaacttgtggct
gccctatacaagagggaaccggattccaacgtcattgtggtggactggctgtctcgggcc
cagcagcattatccaatatctgcgggatacaccaagctggtgggacaggatgtggccacg
tttatcgactggatggcggttgaatttagctatcctcccaacaatgtccacctcctggga
tacagccttggagcccacgctgctggcattgcaggaagtctgaccaagaagaaggtcaat
agaattactggcctagatccagctggacctaacttcgagtatgcagaagctccaagccgc
ctttctcccgacgacgcagattttgtagacgtcttacacacattcaccagagggtcacct
ggccgaagtattggcatccagaaaccagtagggcatgttgacatttatcccaatggaggc
actttccaaccagggtgtaacattggagaagccatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctcgtgaagtgctcccatgagcgctccatccatctcttcatcgac
tctctgttgaatgaagaaaatcctagtaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctctgcctgagttgcagaaagaaccgttgcaacaacttgggctatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcgtgctcagatgccc
tacaaagtcttccattaccaagtaaagatgcgtttttctgggactgagagtgatacccac
accaaccaggcctttgagatctctctatatggcaccgtggccgagagtgaaaacatccct
ttcaccctgcctgaagtctccacaaataagacatactcctttctaatttacacagaggtg
gatattggagagttgctaatgttgaaactcaaatgggtcagtgattcatacttcagctgg
tccaactggtggagcagccctggctttgctattgagaagatcagagtgaaggcaggagag
actcaaaaaaaggtgatcttctgttcccgggagaagaagtctcacctgcagaaaggaaag
tcctctgtggtgtttgtgaaatgccacgacaagtctctgaatagaaagtctggctga

DBGET integrated database retrieval system