KEGG   Sus scrofa (pig): 397632Help
Entry
397632            CDS       T01009                                 

Gene name
PLCZ, PLC-zeta-1, PLCZ1
Definition
phospholipase c-zeta (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ssc00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:ssc04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ssc04070]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ssc04114]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ssc04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 636 aa AA seqDB search
MENKWFLSMVRDDFKGGKINLEKAQKLLEKLDIQCNTIHVKCIFKDNDRLKQGRITIEEF
RTIYRIIAHREEIIEIFNAYPENRKILFERNLIDFLTQEQYSLDINRSIVYEIIQKYEPI
EEVKQAHQMSFEGFTRDMGSSECLLFNNECGSVYQDMTHPLSDYFISSSHNTYLISDQIM
GPSNLWGYVSALVKGCRCLEIDCWDGSQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFITS
DYPVVLSLENHCSLSQQEVMADNLQSVFGDALLSDVLDDCPDRLPSPEALKFKILVRNKK
IGTLKETHERKGFDKHGQVQECEEEEEAEQEEEENEVRDSEILDILQDDLEKEELKRGVG
IKFFKKKKVKIATALSDLVIYTKVEKFRSFHYSRLYQQFNETNSIGETQARKLSKLRASE
FILHTRKFITRIYPKATRADSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLENGN
SGYILKPHFLRDGKSIFNPNKAPINSNPITLTIRLISGIQLPPSYHSSSNKADTLVIIEI
FGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIQVPELALIRFVVENQGLITGNEFLGQYT
LPVLCMNKGYRRVPLFSKMGESLEPASLFIYVWYIR
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaatggtttttgtccatggttcgggatgactttaaaggtggaaaaattaat
ctagaaaaagctcagaaattacttgaaaaattagatattcagtgcaatactattcatgtg
aaatgtatttttaaggataatgacaggctgaagcaaggaagaatcaccatagaagaattc
agaacaatttatcgaattattgcacacagagaagaaattattgagattttcaacgcctat
cccgaaaaccggaaaattctttttgaaaggaatctgattgattttttgacccaagagcag
tattcacttgacattaatagaagtattgtttatgagatcattcaaaaatatgaacctatt
gaagaagttaagcaagcacaccagatgtcatttgaaggttttacaagagatatgggttca
tctgaatgtctactatttaataatgagtgtggaagtgtttatcaagatatgacccatcca
ttgagtgattattttatttcaagttcacataatacatacttgatatctgaccaaataatg
ggaccaagtaacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtctggaa
attgactgctgggatggatcgcaaaatgaacctgttgtataccacggttacacattaacc
agcaagcttctgtttaaaactgttatccaagcaatacacaaatatgcattcataacctct
gactacccagtggtgctctctttagaaaatcactgttccctttcccaacaagaagtgatg
gcagacaatttgcagtctgtttttggagatgccttgctttctgatgtgcttgatgattgt
ccagacagactaccttcaccagaggcattaaaattcaaaatattagttagaaacaagaaa
ataggaaccttaaaggaaactcacgaaaggaaaggttttgataagcatggtcaggtacag
gaatgtgaagaagaagaggaggcagaacaagaggaggaagaaaatgaggtcagagattca
gaaatattggatattttacaagatgatttggaaaaggaagagttgaaacggggagttgga
attaaatttttcaagaaaaagaaggtaaaaatagctacggccctatctgatcttgttatt
tatactaaagttgagaagttcagaagttttcactattcaaggctttatcaacaatttaat
gaaactaactctattggggaaacacaagcccgaaaactttcaaagttgagagccagtgaa
tttattcttcacactaggaagttcattaccagaatatatcccaaagcgacaagagcagac
tcctctaattttaatcctcaagaattttggaatataggttgtcaaatggtggccttaaat
ttccagacccctggtctgcctatggatcttcaaaatgggaaatttttagaaaatggtaac
tctggatatattttgaaaccacacttcttaagagatggtaaatcaatatttaatccaaac
aaagcaccaatcaacagtaatccaattacacttaccataaggctcatcagtggtatccag
ttgcctcccagttatcattcatcatccaacaaagctgatacattggtgataatagaaatt
tttggtgtgccaaatgatcaaatgaaacagcagacacgtgtaattaagaaaaatgctttt
agtccaagatggaatgaaacattcacattcattattcaggtgccagaattggcattaata
cgttttgttgttgaaaatcaaggtttgataactggaaatgaatttcttgggcaatatact
ttaccagttctatgcatgaacaaaggttaccgtcgtgttcctctgttttctaaaatgggt
gagagtcttgaacctgcctccctatttatttatgtttggtacatcagatag

DBGET integrated database retrieval system