KEGG   Sus scrofa (pig): 397652Help
Entry
397652            CDS       T01009                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04020  Calcium signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04114  Oocyte meiosis
ssc04140  Autophagy - animal
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04270  Vascular smooth muscle contraction
ssc04310  Wnt signaling pathway
ssc04340  Hedgehog signaling pathway
ssc04371  Apelin signaling pathway
ssc04530  Tight junction
ssc04540  Gap junction
ssc04611  Platelet activation
ssc04713  Circadian entrainment
ssc04714  Thermogenesis
ssc04720  Long-term potentiation
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04727  GABAergic synapse
ssc04728  Dopaminergic synapse
ssc04740  Olfactory transduction
ssc04742  Taste transduction
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04910  Insulin signaling pathway
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04913  Ovarian steroidogenesis
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04924  Renin secretion
ssc04925  Aldosterone synthesis and secretion
ssc04926  Relaxin signaling pathway
ssc04927  Cortisol synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing's syndrome
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04962  Vasopressin-regulated water reabsorption
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04976  Bile secretion
ssc05012  Parkinson's disease
ssc05020  Prion diseases
ssc05030  Cocaine addiction
ssc05031  Amphetamine addiction
ssc05032  Morphine addiction
ssc05146  Amoebiasis
ssc05165  Human papillomavirus infection
ssc05166  HTLV-I infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05414  Dilated cardiomyopathy (DCM)
Module
ssc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    397652 (PRKACA)
   04010 MAPK signaling pathway
    397652 (PRKACA)
   04310 Wnt signaling pathway
    397652 (PRKACA)
   04340 Hedgehog signaling pathway
    397652 (PRKACA)
   04371 Apelin signaling pathway
    397652 (PRKACA)
   04020 Calcium signaling pathway
    397652 (PRKACA)
   04024 cAMP signaling pathway
    397652 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    397652 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    397652 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    397652 (PRKACA)
   04540 Gap junction
    397652 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    397652 (PRKACA)
   04062 Chemokine signaling pathway
    397652 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    397652 (PRKACA)
   04910 Insulin signaling pathway
    397652 (PRKACA)
   04922 Glucagon signaling pathway
    397652 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    397652 (PRKACA)
   04912 GnRH signaling pathway
    397652 (PRKACA)
   04913 Ovarian Steroidogenesis
    397652 (PRKACA)
   04915 Estrogen signaling pathway
    397652 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    397652 (PRKACA)
   04921 Oxytocin signaling pathway
    397652 (PRKACA)
   04926 Relaxin signaling pathway
    397652 (PRKACA)
   04918 Thyroid hormone synthesis
    397652 (PRKACA)
   04919 Thyroid hormone signaling pathway
    397652 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    397652 (PRKACA)
   04916 Melanogenesis
    397652 (PRKACA)
   04924 Renin secretion
    397652 (PRKACA)
   04925 Aldosterone synthesis and secretion
    397652 (PRKACA)
   04927 Cortisol synthesis and secretion
    397652 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397652 (PRKACA)
   04270 Vascular smooth muscle contraction
    397652 (PRKACA)
  Digestive system
   04970 Salivary secretion
    397652 (PRKACA)
   04971 Gastric acid secretion
    397652 (PRKACA)
   04976 Bile secretion
    397652 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    397652 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    397652 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    397652 (PRKACA)
   04727 GABAergic synapse
    397652 (PRKACA)
   04725 Cholinergic synapse
    397652 (PRKACA)
   04728 Dopaminergic synapse
    397652 (PRKACA)
   04726 Serotonergic synapse
    397652 (PRKACA)
   04720 Long-term potentiation
    397652 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    397652 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    397652 (PRKACA)
   04742 Taste transduction
    397652 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    397652 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    397652 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    397652 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    397652 (PRKACA)
   04714 Thermogenesis
    397652 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    397652 (PRKACA)
   05205 Proteoglycans in cancer
    397652 (PRKACA)
   05203 Viral carcinogenesis
    397652 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    397652 (PRKACA)
   05020 Prion diseases
    397652 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    397652 (PRKACA)
   05031 Amphetamine addiction
    397652 (PRKACA)
   05032 Morphine addiction
    397652 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    397652 (PRKACA)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    397652 (PRKACA)
  Infectious diseases
   05166 HTLV-I infection
    397652 (PRKACA)
   05169 Epstein-Barr virus infection
    397652 (PRKACA)
   05165 Human papillomavirus infection
    397652 (PRKACA)
   05146 Amoebiasis
    397652 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    397652 (PRKACA)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     397652 (PRKACA)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  PKA family
   397652 (PRKACA)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     397652 (PRKACA)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    397652 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 397652
NCBI-ProteinID: XP_003123401
Ensembl: ENSSSCG00000013771
UniProt: F1SD45
Structure
PDB: 

Jmol
Position
2
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ttggatcaatttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaagcacaaggagactgggaaccactttgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagattgagcacaccctgaatgaaaagcgcatcctgcaagcagtcaac
ttcccgttccttgtcaaactcgagttctccttcaaggacaactcaaatttatacatggtc
atggaatatgtgcctggtggggagatgttctcacacctgcggaggatcgggaggttcagt
gagccccatgcccgcttctacgcggcccagattgtcctgaccttcgagtacctgcactcg
cttgatctcatctaccgggacctgaagccggagaaccttctcatcgaccagcagggctac
attcaggtgacagacttcggttttgccaaacgtgtgaaaggccgcacctggactttgtgt
gggacacccgagtacctggcccctgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggttctcatctatgagatggccgctggctacccgcccttcttc
gctgaccagcccatccagatctacgagaagattgtctccgggaaggtgcggttcccgtcc
cacttcagctccgacctgaaggatctgcttcggaacctcctgcaggtggacctcaccaaa
cgctttgggaaccttaagaacggagtcaatgacatcaagaaccacaagtggtttgccacg
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgatgactatgaggaagaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system