KEGG   Sus scrofa (pig): 397681Help
Entry
397681            CDS       T01009                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
ssc  Sus scrofa (pig)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    397681 (APOA4)
   04977 Vitamin digestion and absorption
    397681 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 382 aa AA seqDB search
MFLKAVVLSLALVAVTGARAEVNADQVATVMWDYFSQLGSNAKKAVEHLQKSELTQQLNT
LFQDKLGEVNTYTEDLQKKLVPFATELHERLTKDSEKLKEEIRRELEELRARLLPHATEV
SQKIGDNVRELQQRLGPFTGGLRTQVNTQVQQLQRQLKPYAERMESVLRQNIRNLEASVA
PYADEFKAKIDQNVEELKGSLTPYAEELKAKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKQAEELKAKISANADELRQKLVPVAENVHGHLKGNTEGLQKSLLELRSHLDQQV
EEFRLKVEPYGETFNKALVQQVEDLRQKLGPLAGDVEGHLSFLEKDLRDKVNTFFSTLKE
EASQGQSQALPAQEKAQAPLEG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtcctgagcctggccctggtggccgtcaccggtgcccgggct
gaggtcaatgccgaccaagtggctactgtgatgtgggactacttcagccagctgggcagc
aatgccaagaaggctgtggaacatctccagaagtctgagctcacccagcagctcaacact
ctcttccaggacaaacttggggaagtgaacacctacacggaggacctgcagaagaagctg
gtgccctttgccacggagctgcatgaacgcctgaccaaggactcagagaagctgaaggag
gagattcgaagggagctggaggagctgcgagcccggctgctgccccacgctaccgaggtg
agccagaaaatcggagacaacgtgcgcgagctgcagcagcgcctggggccctttacggga
gggctgcgcacccaggtcaacacccaggttcagcagctgcagcgccagctgaagccctac
gcagagcgcatggagtccgtgctacggcagaacatccgcaacctggaggcctccgtggca
ccctatgcggatgagttcaaggccaagatcgatcagaatgtggaggagctcaaggggagc
ctcacgccctatgcggaggagctcaaggccaagatcgatcagaacgtggaggagctgcgg
cgcagcctggccccctatgcgcaggacgtccaggagaagctcaaccaccagctcgagggc
ctggccttccagatgaagaagcaggcagaggagctgaaggccaagatctcggccaatgcc
gacgagctgcggcagaagctggtgccggtggccgagaacgtgcatggccatctgaagggc
aacaccgaggggctgcagaagtcgctgctggagctgagaagccacctggaccagcaggtg
gaggagttccgcctcaaggtggagccctacggggagaccttcaacaaagctttggtgcag
caggtggaggatctcaggcagaagctgggccctttggcgggggacgtggagggccacctg
agcttcctggagaaggatctgagggacaaggtcaacaccttcttcagcaccctcaaagag
gaggcgagccagggccagagccaggccctccctgcacaggagaaggcgcaggcccctttg
gagggctga

DBGET integrated database retrieval system