KEGG   Sus scrofa (pig): 397681Help
Entry
397681            CDS       T01009                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A-IV precursor
  KO
K08760  
apolipoprotein A-IV
Organism
ssc  Sus scrofa (pig)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    397681 (APOA4)
   04979 Cholesterol metabolism
    397681 (APOA4)
   04977 Vitamin digestion and absorption
    397681 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
9
AA seq 382 aa AA seqDB search
MFLKAVVLSLALVAVTGARAEVNADQVATVMWDYFSQLGSNAKKAVEHLQKSELTQQLNT
LFQDKLGEVNTYTEDLQKKLVPFATELHERLTKDSEKLKEEIRRELEELRARLLPHATEV
SQKIGDNVRELQQRLGPFTGGLRTQVNTQVQQLQRQLKPYAERMESVLRQNIRNLEASVA
PYADEFKAKIDQNVEELKGSLTPYAEELKAKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKQAEELKAKISANADELRQKLVPVAENVHGHLKGNTEGLQKSLLELRSHLDQQV
EEFRLKVEPYGETFNKALVQQVEDLRQKLGPLAGDVEGHLSFLEKDLRDKVNTFFSTLKE
EASQGQSQALPAQEKAQAPLEG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtcctgagcctggccctggtggccgtcaccggtgcccgggct
gaggtcaatgccgaccaagtggctactgtgatgtgggactacttcagccagctgggcagc
aatgccaagaaggctgtggaacatctccagaagtctgagctcacccagcagctcaacact
ctcttccaggacaaacttggggaagtgaacacctacacggaggacctgcagaagaagctg
gtgccctttgccacggagctgcatgaacgcctgaccaaggactcagagaagctgaaggag
gagattcgaagggagctggaggagctgcgagcccggctgctgccccacgctaccgaggtg
agccagaaaatcggagacaacgtgcgcgagctgcagcagcgcctggggccctttacggga
gggctgcgcacccaggtcaacacccaggttcagcagctgcagcgccagctgaagccctac
gcagagcgcatggagtccgtgctacggcagaacatccgcaacctggaggcctccgtggca
ccctatgcggatgagttcaaggccaagatcgatcagaatgtggaggagctcaaggggagc
ctcacgccctatgcggaggagctcaaggccaagatcgatcagaacgtggaggagctgcgg
cgcagcctggccccctatgcgcaggacgtccaggagaagctcaaccaccagctcgagggc
ctggccttccagatgaagaagcaggcagaggagctgaaggccaagatctcggccaatgcc
gacgagctgcggcagaagctggtgccggtggccgagaacgtgcatggccatctgaagggc
aacaccgaggggctgcagaagtcgctgctggagctgagaagccacctggaccagcaggtg
gaggagttccgcctcaaggtggagccctacggggagaccttcaacaaagctttggtgcag
caggtggaggatctcaggcagaagctgggccctttggcgggggacgtggagggccacctg
agcttcctggagaaggatctgagggacaaggtcaacaccttcttcagcaccctcaaagag
gaggcgagccagggccagagccaggccctccctgcacaggagaaggcgcaggcccctttg
gagggctga

DBGET integrated database retrieval system