KEGG   Sus scrofa (pig): 397687Help
Entry
397687            CDS       T01009                                 

Gene name
CYP2D25, CYPIID25
Definition
vitamin D3 25-Hydroxylase (EC:1.14.13.15)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    397687 (CYP2D25)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    397687 (CYP2D25)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     397687 (CYP2D25)
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP2 family
   397687 (CYP2D25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 500 aa AA seqDB search
MGLLTGDLLGILALAMVIFLLLVDLMHRRSRWAPRYPPGPMPLPGLGNLLQVNFQDPRLS
FIQLRRRFGDVFSLQQIWRPVVVLNGLAAVREALVSHSHETSDRPPVFILEHLGYGPRSE
GVILARYGKAWREQRRFSVSTLRNFGLGKKSLEEWVTQEASCLCAAFADQAGRPFSPNNL
LNKAVSNVIASLTFARRFEYNDPRMLKLLDLVLEGLKEEVGLMRQVLEAMPVLRHIPGLC
AKLFPRQKAFLVMIDELITEHKMTRDLAQPPRDLTDAFLDEMKEAKGNPESSFNDENLRL
VVAHLFSAGMITTSTTLAWALLLMILHPDVQRRVQQEIDEVIGHVRQPEIKDQALMPFTL
AVLHEVQRFGDIVPLGVAHMTSCDIEVQGFLIPKGTTLITNLTSVLKDETVWKKPFRFYP
EHFLDAQGRFTKQEAFMPFSAGRRSCLGEPLARMELFLFFTTLLQAFSFSVPTGQPCPSD
HGVFAFLLFPSPYQLCAVPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgctgactggggatttactggggatcctggccttggccatggtcatcttcctg
ctcctggtggacttgatgcaccggcgctcacgctgggctccacgctacccaccgggcccc
atgccactgcctgggctgggtaacctgctacaagtgaacttccaagacccacgtctcagc
tttatccagctgcggcgccgctttggggatgtattcagcctgcagcagatctggaggccc
gtggtcgtgctcaatgggctggcggctgtgcgggaggcgctggtgtcccacagccatgaa
acctccgaccgcccacctgtgttcatcttagagcacctgggttacgggccgcgctccgaa
ggagtgatcctggcgcgctacgggaaagcgtggcgcgagcagcggcgcttctcggtgtcc
accttgcgcaactttggcctgggcaagaagtcgttggaggagtgggtgacccaagaggcc
tcgtgcctttgtgccgccttcgccgaccaggctggacgcccctttagccctaacaacctt
ctgaataaagcggtgagcaacgtgatcgcctccctcaccttcgcgcgccgcttcgagtac
aacgaccctcgcatgctcaagcttctggacctagtgttggaaggactgaaggaggaagtg
ggcctcatgcgccaggtgctggaagcaatgccggttctcaggcatatcccggggctgtgt
gccaagctcttcccaaggcagaaggccttcttggtcatgatagatgagctgatcacagag
cacaagatgacccgggacctggcccagcccccccgagacttgacggatgccttcctggac
gaaatgaaagaggccaaggggaaccccgagagcagcttcaatgatgagaacctccgcctg
gtggtggctcacctgttctccgctgggatgatcaccacctcgaccacgctggcctgggct
ctcctcctcatgatcctgcacccagacgtgcagcgacgcgtccaacaggaaatcgatgag
gtgatagggcacgtgcggcaaccggagataaaggatcaggccctcatgcccttcaccttg
gccgtgctccatgaggtgcagcgctttggggacatcgtcccactgggcgtggcccacatg
acatcttgtgacattgaagtgcagggtttcctcatccccaaggggaccacacttatcacc
aacctgacgtcagtgctgaaggacgagactgtctggaagaagcccttccgcttctatcca
gagcacttcctggacgcccagggccgcttcaccaagcaggaggccttcatgcccttctca
gcaggccgccgctcttgcctcggggagcccctggcccgcatggagctcttcctcttcttc
accaccctcctgcaggcgttcagcttctcggtgcccacaggacagccttgccccagcgac
cacggtgtctttgccttcctgctgttcccatccccctaccagctctgtgctgtgccccgc
tag

DBGET integrated database retrieval system