KEGG   Sus scrofa (pig): 397690Help
Entry
397690            CDS       T01009                                 

Gene name
DLST, DLST-tv1
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssc  Sus scrofa (pig)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    397690 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    397690 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    397690 (DLST)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     397690 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 455 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGISLCQGPGYPDSRKIVISNSSVLNVRF
FRTTAVCKDDVITVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPA
NGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPAVSAVPPPPAA
SIPTQMPPVPSPPQPLTSKPVSAVKPTAAPPVAEPGAVKGLRAEHREKMNRMRQRIAQRL
KEAQNTCAMLTTFNEIDMSNIQDMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVV
NAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTISELGEKARKNE
LAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIVDRPVAVGGKVEIRPMMYV
ALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcccgctgcgtgtcccgggcgttcagccgttcgctttccgcctttcag
aaggggaactgccctctagggagacgttccctgcctgggatctccttatgtcagggacca
ggttaccctgacagcaggaagattgtcattagcaacagtagtgtcttgaatgttcgattc
ttcagaactacagctgtgtgcaaggatgatgtgattacagtcaaaaccccagcatttgca
gaatctgtcacagaaggagatgtcaggtgggagaaagctgttggagacacggttgcagaa
gatgaagtggtttgtgagattgaaactgacaagacatctgtgcaggttccatcaccagca
aatggcgtgattgaagctcttttggtacccgatgggggaaaagtagaaggaggcactcct
cttttcacactcaggaaaactggcgctgctcctgctaaggccaagccagctgaagctcct
gctgctgcagccccaaaagcagaacctgcagtgtcagcagttcctcctccccctgcagca
tctatccccactcagatgccaccagtgccctcacccccacaacctcttactagcaaacct
gtgtctgcagtaaaacccactgctgcccctccagtagctgagcccggagctgtcaagggt
ctgcgcgcagaacatcgggagaaaatgaacaggatgcggcagcgcatcgctcagcgtctg
aaggaggcccagaacacctgcgcgatgctcaccactttcaatgagattgacatgagtaac
atccaggacatgagggctcggcacaaagaagcttttctgaagaaacataacctcaaacta
ggcttcatgtcggcatttgtgaaggcctcagccttcgccttgcaggagcagcctgttgta
aatgcagtgattgatgatacaaccaaagaggtggtgtatagggattatattgacatcagc
gtcgcagtggccacccctcggggtctggtggttcccgtcatcaggaatgtggaaactatg
aattacgccgatattgagcgaaccatcagtgaactgggagagaaggccagaaagaatgaa
cttgctattgaagatatggatggtggcactttcaccatcagcaatggaggcgttttcggc
tccctctttggaacgcccatcatcaaccccccgcagtctgccatcctgggcatgcacgcc
atcgttgataggccagtggccgtgggaggcaaggtggagatacggcccatgatgtacgtg
gccctgacgtatgatcaccggctgatcgacggtagagaggccgtaactttcctccgcaaa
atcaaggcagcggtagaggatcccagagtcctcctactggacctttag

DBGET integrated database retrieval system