KEGG   Sus scrofa (pig): 399525Help
Entry
399525            CDS       T01009                                 

Gene name
GLS
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X1
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    399525 (GLS)
   00220 Arginine biosynthesis
    399525 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    399525 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    399525 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    399525 (GLS)
   04727 GABAergic synapse
    399525 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    399525 (GLS)
   05206 MicroRNAs in cancer
    399525 (GLS)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     399525 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
15
AA seq 669 aa AA seqDB search
MMRLRGSAMLRNLLLRPPAATCAVLRRAQPLATLCRRSRGGGRTGPAAAARLHPWWGGGG
RPAGPLARGLSSSPSEILQELGKGGTQQQQQPGASPPAAPPAPSPKDSPGETDGFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcggaacctgctcctgcggccgcccgccgct
acctgcgcggttctgaggcgggcgcagcccctcgccaccctgtgccggcgctcccggggc
gggggacgaacgggccctgcggccgccgcgcggctccacccgtggtggggcgggggcggc
cggccagcggggcccctcgcgaggggcctgtccagctccccttcggagatcctgcaggag
ctgggcaaagggggcacgcagcagcagcagcagcccggggcgtcgccgcccgcggccccg
ccggcgcccagccccaaggacagcccgggggaaacggacgggttcggcaacagcgagggc
aaggagctggtggcttccggcgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgccgaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcaaagcaacattgttttgctgacacaagcctttagaagaaagtttgtc
attcctgactttatgtcttttacatcacatatcgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactagccaagttcagtcctgatttg
tggggtgtgtctgtttgtacagtagatggacagaggcattctattggagataccaaagtt
ccattttgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgacctt
ggaacagagtatgtgcatcgatatgttgggaaagagccaagtggattaagattcaacaaa
ctttttttaaatgaagatgataaaccacacaatcctatggtaaatgctggagcaattgtt
gtaacttcattaataaagcaaggagtgaataatgctgaaaaatttgactatgtaatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaaaaagtgt
tttccagaaggcacagacatggttggtatattagacttctatttccagctatgctccatt
gaagtaacttgtgaatcagctagtgtgatggcagcaacactggctaatggtggcttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatacactcagtttgatg
cattcatgtggcatgtatgatttctcagggcagtttgctttccatgttggtcttcctgca
aaatctggagttgctggaggcattcttttagttgtccccaatgtcatgggcatgatgtgc
tggtctcctcctctggacaagatgggcaacagtgttaagggaattcacttctgtcatgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaaccttttatttgct
gcatatactggagatgtatctgcacttcgaagatttgctctgtcagccatggacatggaa
cagagagactatgattctaggacagcactccatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctagaagcctgcaaagtaaatcctttccccaaggacaggtggaat
aacacacccatggatgaagcactgcactttgggcaccatgatgtatttaaaatcctccag
gagtaccaagtccagtacacacctcaaggagattccgacaatggaaaggaaaatcaaacc
gtccataaaaatcttgatggattgttataa

DBGET integrated database retrieval system