KEGG   Sus scrofa (pig): 403104Help
Entry
403104            CDS       T01009                                 

Gene name
CYP2B22
Definition
cytochrome P450 2B22
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    403104 (CYP2B22)
   00590 Arachidonic acid metabolism
    403104 (CYP2B22)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    403104 (CYP2B22)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    403104 (CYP2B22)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     403104 (CYP2B22)
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP2 family
   403104 (CYP2B22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 493 aa AA seqDB search
MMMFSAILLLIVLIGVFLLWGHPSSQGHLPPGPRPLPFLGNILQMDRKGFLKSFQALRER
YGDVFTVYLGPRPVVMICGTEAIREALVDQAEAFSGRGKIAVVEPIFQGYGVIFSNGERW
KTLRRFSLATMRDFGLGKRSVEERIQEEAQCLVEELRKSQGALQDPTYYFHSSTANIICS
IVFGKRFAYRDPEFLQLLDLLFQTFLLISSFPSQLFELYSAFLKYFPGSHRQIYKNLQQV
NAFIGRSVEKHRETLDPSDPRDLIDSYLLRMDKEKSNPNSEFHEQNLILTVLSLFFAGTE
TTSTTLRYGFLLMLKYPHITERIHKEIDRVIGSHRPPALDDRAKMPYMDAVIHEMQRFGD
LIPMGVPHTVTKDTHFRGYLLPKGTEVYPILTSALHDPRYFENPEAFNPDHFLDATGALK
KNDAFMPFSIGKRICLGEGLARTELFLFFTTILQNFSVASPVAPEDIDLTPQAVGVGTVP
PPYQIQFLPRQRG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgttctctgccatcctgctgctcattgtcctcattggcgtcttcctcctctgg
ggccaccctagctcccaggggcaccttccccctggaccccggcctctgcccttcctgggg
aacattctgcaaatggaccgaaagggctttctcaagtccttccaggcgctccgagagaga
tacggggatgtattcacggtgtacctggggccaaggccagtggtcatgatatgcgggaca
gaggccattcgggaggccctggtggaccaggctgaggccttctctggccgagggaaaatc
gctgtggtggagccaatcttccagggatatggcgtgatcttttccaacggggaacgttgg
aagacccttcggcgcttctctctggccaccatgagggacttcggcctgggaaaacggagc
gtggaggagcggattcaggaggaggcccagtgtctggtggaggagctgcggaaatcccag
ggagccctccaggaccccacctactacttccactccagcactgccaacatcatctgctcc
attgtctttggaaaacgcttcgcctacagagatcccgagttcctgcagctgctggactta
ctgttccagacctttctgctcatcagctcctttcccagccagctgttcgagctctactcc
gccttcttgaagtactttccaggctcacacaggcaaatctacaaaaacctgcagcaagtc
aatgccttcattggccgcagtgtggagaagcaccgtgaaaccctggaccccagcgacccc
cgggacctcatcgacagctacctgctccgcatggacaaagagaagtccaaccccaacagc
gagttccacgagcagaacctcatcctcactgtcctttcgctcttctttgccggcaccgag
accaccagcaccactctccgctatggattcctgctcatgctcaagtacccccacatcaca
gagagaatccacaaggagatcgaccgggtgattggttctcatcgacctccagccttggac
gacagagccaagatgccatacatggatgcggtcattcatgagatgcagagatttggggac
ctcatccccatgggtgttccccacacggtcactaaagacactcacttccgagggtacctc
ctccccaagggcacagaagtctatcccatcctgacctctgctctccatgacccacgttac
tttgaaaacccagaggccttcaaccctgaccactttctggatgccactggggccctgaag
aaaaatgacgcttttatgcccttctccataggcaagcgcatttgtcttggggaaggcctg
gcccgcaccgaattattcctcttcttcaccaccatcctccagaacttctccgtggccagc
cccgtggctccggaggacatcgacctgacaccccaggctgttggggtgggcacagtgccc
ccgccctaccagatccagttcctgccccgccaaagaggctga

DBGET integrated database retrieval system