KEGG   Sus scrofa (pig): 403104Help
Entry
403104            CDS       T01009                                 

Gene name
CYP2B22
Definition
cytochrome P450 2B22
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ssc00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ssc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 493 aa AA seqDB search
MMMFSAILLLIVLIGVFLLWGHPSSQGHLPPGPRPLPFLGNILQMDRKGFLKSFQALRER
YGDVFTVYLGPRPVVMICGTEAIREALVDQAEAFSGRGKIAVVEPIFQGYGVIFSNGERW
KTLRRFSLATMRDFGLGKRSVEERIQEEAQCLVEELRKSQGALQDPTYYFHSSTANIICS
IVFGKRFAYRDPEFLQLLDLLFQTFLLISSFPSQLFELYSAFLKYFPGSHRQIYKNLQQV
NAFIGRSVEKHRETLDPSDPRDLIDSYLLRMDKEKSNPNSEFHEQNLILTVLSLFFAGTE
TTSTTLRYGFLLMLKYPHITERIHKEIDRVIGSHRPPALDDRAKMPYMDAVIHEMQRFGD
LIPMGVPHTVTKDTHFRGYLLPKGTEVYPILTSALHDPRYFENPEAFNPDHFLDATGALK
KNDAFMPFSIGKRICLGEGLARTELFLFFTTILQNFSVASPVAPEDIDLTPQAVGVGTVP
PPYQIQFLPRQRG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgttctctgccatcctgctgctcattgtcctcattggcgtcttcctcctctgg
ggccaccctagctcccaggggcaccttccccctggaccccggcctctgcccttcctgggg
aacattctgcaaatggaccgaaagggctttctcaagtccttccaggcgctccgagagaga
tacggggatgtattcacggtgtacctggggccaaggccagtggtcatgatatgcgggaca
gaggccattcgggaggccctggtggaccaggctgaggccttctctggccgagggaaaatc
gctgtggtggagccaatcttccagggatatggcgtgatcttttccaacggggaacgttgg
aagacccttcggcgcttctctctggccaccatgagggacttcggcctgggaaaacggagc
gtggaggagcggattcaggaggaggcccagtgtctggtggaggagctgcggaaatcccag
ggagccctccaggaccccacctactacttccactccagcactgccaacatcatctgctcc
attgtctttggaaaacgcttcgcctacagagatcccgagttcctgcagctgctggactta
ctgttccagacctttctgctcatcagctcctttcccagccagctgttcgagctctactcc
gccttcttgaagtactttccaggctcacacaggcaaatctacaaaaacctgcagcaagtc
aatgccttcattggccgcagtgtggagaagcaccgtgaaaccctggaccccagcgacccc
cgggacctcatcgacagctacctgctccgcatggacaaagagaagtccaaccccaacagc
gagttccacgagcagaacctcatcctcactgtcctttcgctcttctttgccggcaccgag
accaccagcaccactctccgctatggattcctgctcatgctcaagtacccccacatcaca
gagagaatccacaaggagatcgaccgggtgattggttctcatcgacctccagccttggac
gacagagccaagatgccatacatggatgcggtcattcatgagatgcagagatttggggac
ctcatccccatgggtgttccccacacggtcactaaagacactcacttccgagggtacctc
ctccccaagggcacagaagtctatcccatcctgacctctgctctccatgacccacgttac
tttgaaaacccagaggccttcaaccctgaccactttctggatgccactggggccctgaag
aaaaatgacgcttttatgcccttctccataggcaagcgcatttgtcttggggaaggcctg
gcccgcaccgaattattcctcttcttcaccaccatcctccagaacttctccgtggccagc
cccgtggctccggaggacatcgacctgacaccccaggctgttggggtgggcacagtgccc
ccgccctaccagatccagttcctgccccgccaaagaggctga

DBGET integrated database retrieval system