KEGG   Sus scrofa (pig): 403107Help
Entry
403107            CDS       T01009                                 

Gene name
CYP2C33
Definition
cytochrome P450 2C33
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ssc00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ssc00830]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:ssc04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ssc04750]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ssc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 494 aa AA seqDB search
MELLGITTLALMVCVTCLVFLSVWKKNHKRRRLPPGPTPLPIIGNLMQLNLKDIPASLSK
LAKQYGPVCTVYFGSQPAVVLHGYEAVKEALIDQGDEFLGRGIIPIIDDTQGGYGLVFSN
GERWKQIRRFSLMTLRNFGMGKRSLEERVQEEAQFLVEELRKTEAQPFDPTFILSCAPCN
VICSILFNDRFHYDNETFLSLMNLLNANFRQISSPWIQIYNLWPQIIKHLPGEHRAFSKR
LKDCRSFILEKVKEHQKSPNLNNPQDYIDCFLSKMEQEKQNPDSEFHLENLINSGSNLFA
AGTETTTSTLRYGLLLLMKHPEVQAKVHEEIDRVIGRSQRPCMQDKMKLPYTEAVLHEIQ
RYIALLPSNLPHATVRDTKFREYIIPKGTTVLPLLSSVLHDCKEFPNPEKFDPGHFLDKD
GSFRKTEYFVPFSIGKRACAGESLARMELFLFFTTILQHFVLKPLKEPKDLETKPISVGL
FNLPPPFKLCLIPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgggaatcactacccttgctcttatggtttgtgttacttgcctggttttc
ctttctgtgtggaagaaaaatcacaagaggagaaggctccccccgggcccaactcccctt
cccatcattgggaatctgatgcaacttaacctcaaggacatccctgcgtctctttccaag
ttggccaaacagtacggccctgtttgtactgtgtactttggatcccagcctgccgtggtc
ttacatggatatgaagcagtgaaggaagctctgattgatcagggggatgaattccttggc
agaggaattattccaattatcgatgatacccagggaggatatggactcgtattcagtaat
ggagagaggtggaagcaaatacggcgcttctccctcatgaccctgaggaactttgggatg
gggaagaggagcctcgaggagagggtccaggaggaagcccagtttctggtggaggagctc
aggaaaacagaggctcagccctttgaccctaccttcatcctctcctgtgctccctgcaat
gtgatctgctccatcctcttcaatgaccgtttccactacgacaatgagacatttctctct
ctgatgaatctgttaaatgcaaattttcgtcaaataagctctccctggatccagatttac
aatctatggccgcaaatcataaagcatctccctggagagcacagagcattttcaaaaagg
cttaaagactgtaggtcttttattctggaaaaagtaaaggagcatcaaaagtccccgaat
cttaacaaccctcaagactacattgactgtttcctcagcaagatggagcaggaaaaacag
aacccagactctgaatttcacctggagaacttgataaactccggatcaaatttgtttgca
gcaggaacagagacaaccactagcaccctgagatatgggctcctgctcctaatgaaacac
cctgaggttcaagccaaagttcatgaagaaattgaccgtgtgattggacgcagccaacgt
ccctgcatgcaggacaagatgaagctgccctacacagaggccgtgttgcatgagatacag
agatacatcgccttacttccttctaacttaccccatgccacagtccgggacacgaaattc
agagagtacatcatccccaagggcactactgtattgccgctactgtcttcagtcttacac
gattgcaaggagtttcccaatccagagaagtttgacccaggccactttttggataaagat
ggcagcttcaggaaaacggaatacttcgtgcctttctccattgggaaacgggcctgtgct
ggagagagcctggctcgcatggagctcttcctgttcttcaccaccattctgcaacacttt
gtcctgaagcccctgaaggagccaaaggacctagagaccaaacccatttcggttgggctt
ttcaacttgccaccacccttcaagctgtgcctcatccctagataa

DBGET integrated database retrieval system