KEGG   Sus scrofa (pig): 403149Help
Entry
403149            CDS       T01009                                 

Gene name
CYP2A19, CYP2A, CYP2A6
Definition
cytochrome P450 2A19
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    403149 (CYP2A19)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     403149 (CYP2A19)
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP2 family
   403149 (CYP2A19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 494 aa AA seqDB search
MLASGLLLVALLTCLTIMVLMSVWRQRKLQGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISQRYGPVFTVHLGPRRIVVLCGYDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGHLIEAFRGTRGAFIDPTYFLSRTVSN
VISSIVFGDRFDYEDKEFLALLRMMLGSFQFTATSTGQLYEMFYSVMKHLPGPQQQAFKD
LQGLEDFIARKVEHNQRTLDPNSPRDFIDSFLIRMQEEKKNPDTEFYWKNLVLTTLNLFF
AGTETVSTTMRYGFLLLMKKPDVEAKVHEEIDRVIGRNRQAKFEDRAKMPYTEAVIHEIQ
RFGDMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLRDPKFFSNPRGFNPQHFLDEN
GQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNILQNFHLKSPQLPQDIDVSPKHVGF
ATIPPTYTMSFQPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcaggcttgcttctcgtggctctgctgacctgcctgaccataatggtcttg
atgtccgtctggcgccagaggaagctccaggggaaactgccccccggacccaccccgctg
cccttcatcgggaactacctgcagctgaacacggagcagatgtacaactccctcatgaag
atcagccagcgctatggccctgtgttcaccgtccacctggggccccggcggatagtggtg
ctgtgtggatacgacgcggtgaaggaggccctggtggaccaggctgaggaattcagcggg
cgaggcgagcaggccactttcgactggctcttcaaaggctatggcgtggccttcagcaac
ggcgagcgtgccaagcagctccggcgcttctccatcaccacgctgcgggacttcggcgtg
ggcaagcggggtatcgaggagcgcatccaggaggaggcgggccacctcatcgaggccttc
cggggcacgcgcggcgcgttcatcgaccccacctacttcctcagccgaacggtttccaat
gtcatcagctccattgtcttcggagaccgctttgactatgaggacaaagagttcctcgca
ctgctgcggatgatgctgggaagctttcagttcacagctacctctaccggacagctctat
gagatgttctactcggtgatgaaacacctgccagggccgcagcaacaggcatttaaggac
ctgcaggggctggaggacttcatagccaggaaggtggaacacaaccagcgcacgctggat
cccaactccccgcgagacttcatcgactccttcctcatccgcatgcaggaggagaagaag
aatcctgacaccgagttctattggaagaacctggttctgaccacactgaacctcttcttc
gcgggcaccgagacggtcagcacaacgatgcgctacggcttcctgctgctcatgaagaaa
ccggatgtggaggccaaagtccacgaggagattgaccgcgtgatcggcaggaaccgccag
gccaagttcgaggaccgggccaagatgccctacacggaggccgtgatccacgagatccag
agattcggagacatgatccccatgggcctggcccgaagagtcaccaaggataccaagttt
cgggacttcctcctccccaagggcactgaggtgttccctatgctgggctctgtgctgaga
gaccccaagttcttctccaacccccgaggcttcaacccccagcacttcctggatgagaac
gggcagtttaagaagaatgatgcttttgtgcccttctccatcggaaagcggtactgtttc
ggagaaggtctggctagaatggagctcttcctcttcctcaccaacatcctgcagaacttc
cacctcaagtctccgcagctgccccaggacatcgacgtgtcccccaaacacgtgggcttc
gccaccatccccccgacctacaccatgagcttccagccccgctga

DBGET integrated database retrieval system