KEGG   Sus scrofa (pig): 403149Help
Entry
403149            CDS       T01009                                 

Gene name
CYP2A19, CYP2A, CYP2A6
Definition
cytochrome P450 2A19
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Retinol metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ssc00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 494 aa AA seqDB search
MLASGLLLVALLTCLTIMVLMSVWRQRKLQGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISQRYGPVFTVHLGPRRIVVLCGYDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGHLIEAFRGTRGAFIDPTYFLSRTVSN
VISSIVFGDRFDYEDKEFLALLRMMLGSFQFTATSTGQLYEMFYSVMKHLPGPQQQAFKD
LQGLEDFIARKVEHNQRTLDPNSPRDFIDSFLIRMQEEKKNPDTEFYWKNLVLTTLNLFF
AGTETVSTTMRYGFLLLMKKPDVEAKVHEEIDRVIGRNRQAKFEDRAKMPYTEAVIHEIQ
RFGDMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLRDPKFFSNPRGFNPQHFLDEN
GQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNILQNFHLKSPQLPQDIDVSPKHVGF
ATIPPTYTMSFQPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcaggcttgcttctcgtggctctgctgacctgcctgaccataatggtcttg
atgtccgtctggcgccagaggaagctccaggggaaactgccccccggacccaccccgctg
cccttcatcgggaactacctgcagctgaacacggagcagatgtacaactccctcatgaag
atcagccagcgctatggccctgtgttcaccgtccacctggggccccggcggatagtggtg
ctgtgtggatacgacgcggtgaaggaggccctggtggaccaggctgaggaattcagcggg
cgaggcgagcaggccactttcgactggctcttcaaaggctatggcgtggccttcagcaac
ggcgagcgtgccaagcagctccggcgcttctccatcaccacgctgcgggacttcggcgtg
ggcaagcggggtatcgaggagcgcatccaggaggaggcgggccacctcatcgaggccttc
cggggcacgcgcggcgcgttcatcgaccccacctacttcctcagccgaacggtttccaat
gtcatcagctccattgtcttcggagaccgctttgactatgaggacaaagagttcctcgca
ctgctgcggatgatgctgggaagctttcagttcacagctacctctaccggacagctctat
gagatgttctactcggtgatgaaacacctgccagggccgcagcaacaggcatttaaggac
ctgcaggggctggaggacttcatagccaggaaggtggaacacaaccagcgcacgctggat
cccaactccccgcgagacttcatcgactccttcctcatccgcatgcaggaggagaagaag
aatcctgacaccgagttctattggaagaacctggttctgaccacactgaacctcttcttc
gcgggcaccgagacggtcagcacaacgatgcgctacggcttcctgctgctcatgaagaaa
ccggatgtggaggccaaagtccacgaggagattgaccgcgtgatcggcaggaaccgccag
gccaagttcgaggaccgggccaagatgccctacacggaggccgtgatccacgagatccag
agattcggagacatgatccccatgggcctggcccgaagagtcaccaaggataccaagttt
cgggacttcctcctccccaagggcactgaggtgttccctatgctgggctctgtgctgaga
gaccccaagttcttctccaacccccgaggcttcaacccccagcacttcctggatgagaac
gggcagtttaagaagaatgatgcttttgtgcccttctccatcggaaagcggtactgtttc
ggagaaggtctggctagaatggagctcttcctcttcctcaccaacatcctgcagaacttc
cacctcaagtctccgcagctgccccaggacatcgacgtgtcccccaaacacgtgggcttc
gccaccatccccccgacctacaccatgagcttccagccccgctga

DBGET integrated database retrieval system