KEGG   Sus scrofa (pig): 403216Help
Entry
403216            CDS       T01009                                 

Gene name
CYP2E1
Definition
cytochrome P450, family 2, subfamily E, polypeptide 1 (EC:1.14.13.n7)
Orthology
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ssc00591]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ssc00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:ssc00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ssc05204]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:ssc04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 495 aa AA seqDB search
MTALGITVALLVWLVTLLLISIWKHIHSSWKLPPGPFPLPIVGNIFQLDLKNIPKSFTML
AERYGPVFTVYLGSRRIVVLHGYKAVKEVLLHYKNEFSGRGEIPTFQVHKDKGVIFNNGP
TWRDTRRFSLTTLRDFGMGKQGNEQRIQREAHFLLEALRKTHGQPFDPTFLIGCAPCNVI
SDILFRQHFDYNDKTCLRLMSMFNENFYLLSTGWIQLYNNFSGYLRYLPGSHRKLMKNIS
EIKDYALERVKDHRDSLEPSCPRDFTDTLLMEMEKEKYSAEPIYTLDNIAVTVADMFFAG
TETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPNRIPAIKDRLVMPYLDAVVHEIQRF
IDLIPSNLPHEATRDTDFRDYIIPKGTVVIPTLDSVLYDSQEFPEPEKFKPEHFLNENGK
FKYSDHFKAFSAGKRVCVGEGLARMELFLFMAAILQHFNLKSLVDPKDIDLSPIAIGFAK
IPPHYKLCVIPRSQV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctgggcatcacggtggccctgctggtgtggttggtcaccctgctgctcatc
tccatctggaagcacatccacagtagctggaaacttccccctggccctttcccactgccc
atcgttgggaacattttccagttggaccttaagaatattcccaaatccttcaccatgctg
gcagagcgttacgggccggtgttcactgtgtacctgggttcgcggcgcattgtggtcctg
cacggctacaaggccgtgaaggaggtcttgctccactacaagaatgagttctctggcaga
ggggaaatccccacgttccaagtgcacaaggacaaaggggtcattttcaataatggacca
acctggcgggacactcggcggttctccctcaccaccctccgtgacttcgggatggggaaa
cagggcaatgagcagcggatccagagggaggcccacttcctgctggaggcactcaggaag
acccatggccagccctttgatcccaccttcctcatcggctgcgcaccctgcaatgtcatc
tccgacatcctcttccgccagcactttgactacaatgacaagacctgtctgaggttaatg
agcatgttcaatgagaacttctacctgctcagtaccggctggatccagctttataataat
ttctcaggctatctacgctacctgcctggaagccataggaaactaatgaaaaatatatct
gaaataaaagattatgctttagaaagagtgaaggaccaccgggattcactggagcccagc
tgtcctcgagatttcactgacaccctgctgatggaaatggagaaggaaaaatacagtgca
gaacctatatacaccttggacaacattgccgtgaccgtggccgacatgttctttgcgggg
acagagaccaccagcaccaccctgagatacgggctcctaattctcatgaaatacccagag
gttgaagagaaacttcatgaagaaattgacagggtcattggtccaaacagaatccctgcc
atcaaggacaggctggtcatgccctacctggatgccgtggtacatgagattcagcgattc
atcgacctcattccctccaacctgccacatgaagcaacccgggacacagatttcagagac
tacatcatccccaagggcacagtggtaattccgacactggactccgtcttatatgacagc
caagaattccctgagccggagaagtttaagccagagcactttctgaatgaaaacggaaag
ttcaagtacagtgatcatttcaaggcattttccgcaggaaagcgggtgtgtgtcggagag
ggcctggctcgcatggaactgttcctgttcatggctgccatcttgcagcactttaacttg
aaatctcttgttgaccccaaggatatcgacctcagccccatcgcgattgggtttgccaag
attcccccccattacaaactctgtgtcattccccgctcacaagtgtga

DBGET integrated database retrieval system