KEGG   Sus scrofa (pig): 403216Help
Entry
403216            CDS       T01009                                 

Gene name
CYP2E1
Definition
cytochrome P450, family 2, subfamily E, polypeptide 1 (EC:1.14.13.n7)
Orthology
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    403216 (CYP2E1)
   00590 Arachidonic acid metabolism
    403216 (CYP2E1)
   00591 Linoleic acid metabolism
    403216 (CYP2E1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    403216 (CYP2E1)
   00982 Drug metabolism - cytochrome P450
    403216 (CYP2E1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    403216 (CYP2E1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    403216 (CYP2E1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     403216 (CYP2E1)
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP2 family
   403216 (CYP2E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 495 aa AA seqDB search
MTALGITVALLVWLVTLLLISIWKHIHSSWKLPPGPFPLPIVGNIFQLDLKNIPKSFTML
AERYGPVFTVYLGSRRIVVLHGYKAVKEVLLHYKNEFSGRGEIPTFQVHKDKGVIFNNGP
TWRDTRRFSLTTLRDFGMGKQGNEQRIQREAHFLLEALRKTHGQPFDPTFLIGCAPCNVI
SDILFRQHFDYNDKTCLRLMSMFNENFYLLSTGWIQLYNNFSGYLRYLPGSHRKLMKNIS
EIKDYALERVKDHRDSLEPSCPRDFTDTLLMEMEKEKYSAEPIYTLDNIAVTVADMFFAG
TETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPNRIPAIKDRLVMPYLDAVVHEIQRF
IDLIPSNLPHEATRDTDFRDYIIPKGTVVIPTLDSVLYDSQEFPEPEKFKPEHFLNENGK
FKYSDHFKAFSAGKRVCVGEGLARMELFLFMAAILQHFNLKSLVDPKDIDLSPIAIGFAK
IPPHYKLCVIPRSQV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctgggcatcacggtggccctgctggtgtggttggtcaccctgctgctcatc
tccatctggaagcacatccacagtagctggaaacttccccctggccctttcccactgccc
atcgttgggaacattttccagttggaccttaagaatattcccaaatccttcaccatgctg
gcagagcgttacgggccggtgttcactgtgtacctgggttcgcggcgcattgtggtcctg
cacggctacaaggccgtgaaggaggtcttgctccactacaagaatgagttctctggcaga
ggggaaatccccacgttccaagtgcacaaggacaaaggggtcattttcaataatggacca
acctggcgggacactcggcggttctccctcaccaccctccgtgacttcgggatggggaaa
cagggcaatgagcagcggatccagagggaggcccacttcctgctggaggcactcaggaag
acccatggccagccctttgatcccaccttcctcatcggctgcgcaccctgcaatgtcatc
tccgacatcctcttccgccagcactttgactacaatgacaagacctgtctgaggttaatg
agcatgttcaatgagaacttctacctgctcagtaccggctggatccagctttataataat
ttctcaggctatctacgctacctgcctggaagccataggaaactaatgaaaaatatatct
gaaataaaagattatgctttagaaagagtgaaggaccaccgggattcactggagcccagc
tgtcctcgagatttcactgacaccctgctgatggaaatggagaaggaaaaatacagtgca
gaacctatatacaccttggacaacattgccgtgaccgtggccgacatgttctttgcgggg
acagagaccaccagcaccaccctgagatacgggctcctaattctcatgaaatacccagag
gttgaagagaaacttcatgaagaaattgacagggtcattggtccaaacagaatccctgcc
atcaaggacaggctggtcatgccctacctggatgccgtggtacatgagattcagcgattc
atcgacctcattccctccaacctgccacatgaagcaacccgggacacagatttcagagac
tacatcatccccaagggcacagtggtaattccgacactggactccgtcttatatgacagc
caagaattccctgagccggagaagtttaagccagagcactttctgaatgaaaacggaaag
ttcaagtacagtgatcatttcaaggcattttccgcaggaaagcgggtgtgtgtcggagag
ggcctggctcgcatggaactgttcctgttcatggctgccatcttgcagcactttaacttg
aaatctcttgttgaccccaaggatatcgacctcagccccatcgcgattgggtttgccaag
attcccccccattacaaactctgtgtcattccccgctcacaagtgtga

DBGET integrated database retrieval system