KEGG   Sus scrofa (pig): 403324Help
Entry
403324            CDS       T01009                                 

Gene name
CYP3A29
Definition
cytochrome P450 3A29 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ssc00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ssc00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ssc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 503 aa AA seqDB search
MDLIPGFSTETWVLLATSLVLLYLYGTYSHGLFKKLGIPGPRPLPYFGNILGYRKGVDHF
DKKCFQQYGKMWGVYDGRQPLLAVTDPNMIKSVLVKECYSVFTNRRSFGPLGAMRNALSL
AEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYS
MDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFDPFLLSLIFFPFLTPIFEVLNITL
FPKSSVNFFTKSVKRMKESRLTDQQKRRVDLLQLMINSQNSKEMDPHKSLSNEELVAQGI
IFIFAGYETTSSALSLLAYELATHPDVQQKLQEEIEATFPNKAPPTYDALAQMEYLDMVV
NETLRLYPIAARLERACKKDVEIHGVFVPKGTVVVVPVFVLHRDPDLWPEPEEFRPERFS
KKHKDTINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFKPCKETQIPLKLTTQ
GLTQPEKPVVLKILPRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacctgatcccaggcttttccacagagacctgggttctcctggctaccagcctggtg
ctcctctatctatatgggacgtattcacatggcctttttaagaagctggggattcctggg
ccaagacctctgccttattttggaaatatcctgggctaccgtaagggtgttgaccatttt
gacaaaaagtgttttcaacagtatgggaaaatgtggggggtttatgatggtcggcagcct
ctgctggctgtcacagatccaaacatgatcaaatcagtcctagtgaaggaatgttattct
gtcttcacaaaccggaggtcttttggtccattgggcgctatgagaaacgctctctctctg
gctgaggatgaagagtggaaaagaatccgaacattgctgtctccgaccttcaccagtgga
aagctcaaggagatgttccccatcattagccattatggagacttgttggtgagcaacctg
aggaaggaagcagagaaaggcaaacctgtgaccatgaaagacatctttggggcctacagc
atggacgtgatcactagcacagcatttggagtgaacatcgattccctcaacaacccacaa
gacccctttgtggaaaacagcaagaagctcttaaaatttagtttctttgatccattcctt
ctctcattaatattctttccattcctcaccccgatcttcgaagtattaaacatcactctg
tttcccaaaagttctgtgaattttttcacgaaatctgtgaaaaggatgaaagaaagtcgc
ctcacagatcaacaaaagcgccgagtggaccttcttcagctgatgattaactcccagaat
tccaaagaaatggacccccataaaagtctgtccaatgaagaacttgtggcccaaggtatt
atttttatttttgctggctacgagaccactagcagtgctctctccctccttgcgtatgaa
ttggccactcaccctgatgtccagcagaagctgcaggaggagattgaggcaactttcccc
aataaggcacctcccacctacgatgccctggcacagatggagtatcttgacatggtagtg
aatgaaactcttagattatacccaattgctgctagacttgagagggcctgtaagaaggat
gtggaaatccatggcgtgttcgttcccaaagggaccgtggtggtggtgccagtcttcgtg
cttcacagagacccggacctctggccagagcctgaggagttccgtcctgaaaggttcagt
aagaagcacaaggacaccataaatccttacacttacctgccctttgggactggaccccgc
aactgcattggcatgaggtttgccctcatgaacatgaaactcgctctcgtcagagtcctg
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattaaccacgcaa
gggcttacacaaccggaaaaacctgtcgttttaaagattttgcccagagatgggaccgta
agtggagcctga

DBGET integrated database retrieval system